object(Exception)#3979 (7) { ["message":protected]=> string(22) "Shop product not found" ["string":"Exception":private]=> string(2866) "Exception: Shop product not found in /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Model/Services/ShopProductManager.php:444 Stack trace: #0 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Controller/ShopProductController.php(228): Shop\Model\Services\ShopProductManager->getShopProductDetails('6253d9fcc47bc65...') #1 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Controller/ShopProductController.php(418): Shop\Controller\ShopProductController->getDetailsData(Object(ArrayObject)) #2 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-mvc/src/Controller/AbstractActionController.php(71): Shop\Controller\ShopProductController->detailsAction() #3 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-eventmanager/src/EventManager.php(319): Laminas\Mvc\Controller\AbstractActionController->onDispatch(Object(Laminas\Mvc\MvcEvent)) #4 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-eventmanager/src/EventManager.php(179): Laminas\EventManager\EventManager->triggerListeners(Object(Laminas\Mvc\MvcEvent), Object(Closure)) #5 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-mvc/src/Controller/AbstractController.php(97): Laminas\EventManager\EventManager->triggerEventUntil(Object(Closure), Object(Laminas\Mvc\MvcEvent)) #6 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-mvc/src/DispatchListener.php(132): Laminas\Mvc\Controller\AbstractController->dispatch(Object(Laminas\Http\PhpEnvironment\Request), Object(Laminas\Http\PhpEnvironment\Response)) #7 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-eventmanager/src/EventManager.php(319): Laminas\Mvc\DispatchListener->onDispatch(Object(Laminas\Mvc\MvcEvent)) #8 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-eventmanager/src/EventManager.php(179): Laminas\EventManager\EventManager->triggerListeners(Object(Laminas\Mvc\MvcEvent), Object(Closure)) #9 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-mvc/src/Application.php(325): Laminas\EventManager\EventManager->triggerEventUntil(Object(Closure), Object(Laminas\Mvc\MvcEvent)) #10 /home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/public/public/index.php(41): Laminas\Mvc\Application->run() #11 {main}" ["code":protected]=> int(0) ["file":protected]=> string(150) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Model/Services/ShopProductManager.php" ["line":protected]=> int(444) ["trace":"Exception":private]=> array(11) { [0]=> array(6) { ["file"]=> string(149) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Controller/ShopProductController.php" ["line"]=> int(228) ["function"]=> string(21) "getShopProductDetails" ["class"]=> string(38) "Shop\Model\Services\ShopProductManager" ["type"]=> string(2) "->" ["args"]=> array(1) { [0]=> string(22) "6253d9fcc47bc657111855" } } [1]=> array(6) { ["file"]=> string(149) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/src/Shop/Controller/ShopProductController.php" ["line"]=> int(418) ["function"]=> string(14) "getDetailsData" ["class"]=> string(37) "Shop\Controller\ShopProductController" ["type"]=> string(2) "->" ["args"]=> array(1) { [0]=> object(ArrayObject)#2452 (1) { ["storage":"ArrayObject":private]=> array(5) { ["id"]=> string(22) "6253d9fcc47bc657111855" ["objectId"]=> string(25) "EN_549296cbd43ea385133062" ["languageId"]=> string(2) "42" ["languageCode"]=> string(2) "en" ["contents"]=> object(ArrayObject)#3781 (1) { ["storage":"ArrayObject":private]=> array(0) { } } } } } } [2]=> array(6) { ["file"]=> string(162) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-mvc/src/Controller/AbstractActionController.php" ["line"]=> int(71) ["function"]=> string(13) "detailsAction" ["class"]=> string(37) "Shop\Controller\ShopProductController" ["type"]=> string(2) "->" ["args"]=> array(0) { } } [3]=> array(6) { ["file"]=> string(148) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/vendor/laminas/laminas-eventmanager/src/EventManager.php" ["line"]=> int(319) ["function"]=> string(10) "onDispatch" ["class"]=> string(47) "Laminas\Mvc\Controller\AbstractActionController" ["type"]=> string(2) "->" ["args"]=> array(1) { [0]=> object(Laminas\Mvc\MvcEvent)#2330 (11) { ["application":protected]=> object(Laminas\Mvc\Application)#2305 (6) { ["defaultListeners":protected]=> array(6) { [0]=> string(13) "RouteListener" [1]=> string(18) "MiddlewareListener" [2]=> string(16) "DispatchListener" [3]=> string(18) "HttpMethodListener" [4]=> string(11) "ViewManager" [5]=> string(20) "SendResponseListener" } ["event":protected]=> *RECURSION* ["events":protected]=> object(Laminas\EventManager\EventManager)#2306 (4) { ["events":protected]=> array(7) { ["route"]=> array(2) { [1]=> array(1) { [0]=> array(2) { [0]=> array(2) { [0]=> object(Laminas\Mvc\RouteListener)#2313 (1) { ["listeners":protected]=> array(1) { [0]=> *RECURSION* } } [1]=> string(7) "onRoute" } [1]=> array(2) { [0]=> object(Laminas\Mvc\ModuleRouteListener)#2372 (1) { ["listeners":protected]=> array(1) { [0]=> *RECURSION* } } [1]=> string(7) "onRoute" } } } [10000]=> array(1) { [0]=> array(1) { [0]=> array(2) { [0]=> object(Laminas\Mvc\HttpMethodListener)#2319 (3) { ["allowedMethods":protected]=> array(10) { [0]=> string(7) "CONNECT" [1]=> string(6) "DELETE" [2]=> string(3) "GET" [3]=> string(4) "HEAD" [4]=> string(7) "OPTIONS" [5]=> string(5) "PATCH" [6]=> string(4) "POST" [7]=> string(3) "PUT" [8]=> string(8) "PROPFIND" [9]=> string(5) "TRACE" } ["enabled":protected]=> bool(true) ["listeners":protected]=> array(1) { [0]=> *RECURSION* } } [1]=> string(7) "onRoute" } } } } ["dispatch"]=> array(2) { [1]=> array(1) { [0]=> array(2) { [0]=> array(2) { [0]=> object(Laminas\Mvc\MiddlewareListener)#2315 (1) { ["listeners":protected]=> array(1) { [0]=> *RECURSION* } } [1]=> string(10) "onDispatch" } [1]=> array(2) { [0]=> object(Laminas\Mvc\DispatchListener)#2317 (2) { ["controllerManager":"Laminas\Mvc\DispatchListener":private]=> object(Laminas\Mvc\Controller\ControllerManager)#580 (16) { ["autoAddInvokableClass":protected]=> bool(false) ["instanceOf":protected]=> string(36) "Laminas\Stdlib\DispatchableInterface" ["abstractFactories":protected]=> array(0) { } ["aliases":protected]=> array(45) { ["MyFirstPlugin"]=> string(36) "Core\Controller\Plugin\MyFirstPlugin" ["Core\Controller\Core"]=> string(30) "Core\Controller\CoreController" ["Core\Controller\LibraryAdmin"]=> string(38) "Core\Controller\LibraryAdminController" ["Core\Controller\Debug"]=> string(31) "Core\Controller\DebugController" ["Core\Controller\Desktop"]=> string(33) "Core\Controller\DesktopController" ["Core\Controller\Diploma"]=> string(38) "Core\Controller\DiplomaAdminController" ["Core\Controller\UnitTest\CoreUnitTest"]=> string(47) "Core\Controller\UnitTest\CoreUnitTestController" ["Core\Controller\UnitTest\CoreAddressUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreAddressUnitTestController" ["Core\Controller\UnitTest\CoreAddressTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreAddressTypeUnitTestController" ["Core\Controller\UnitTest\CoreAjaxRightUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreAjaxRightUnitTestController" ["Core\Controller\UnitTest\CoreContentUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreContentUnitTestController" ["Core\Controller\UnitTest\CoreCurrencyUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreCurrencyUnitTestController" ["Core\Controller\UnitTest\CoreDeliveryTypeUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreDeliveryTypeUnitTestController" ["Core\Controller\UnitTest\CoreEmailUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreEmailUnitTestController" ["Core\Controller\UnitTest\CoreEmailTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreEmailTypeUnitTestController" ["Core\Controller\UnitTest\CoreFormUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreFormUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreFormFieldUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldsetUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreFormFieldsetUnitTestController" ["Core\Controller\UnitTest\CoreLanguageUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreLanguageUnitTestController" ["Core\Controller\UnitTest\CoreLibraryUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreLibraryUnitTestController" ["Core\Controller\UnitTest\CoreLibraryTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryTypeUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryItemUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemTypeUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreLibraryItemTypeUnitTestController" ["Core\Controller\UnitTest\CoreMessageUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreMessageUnitTestController" ["Core\Controller\UnitTest\CoreModuleUnitTest"]=> string(53) "Core\Controller\UnitTest\CoreModuleUnitTestController" ["Core\Controller\UnitTest\CoreModuleParameterUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreModuleParameterUnitTestController" ["Core\Controller\UnitTest\CorePageUnitTest"]=> string(51) "Core\Controller\UnitTest\CorePageUnitTestController" ["Core\Controller\UnitTest\CorePersonUnitTest"]=> string(53) "Core\Controller\UnitTest\CorePersonUnitTestController" ["Core\Controller\UnitTest\CorePersonRelationUnitTest"]=> string(61) "Core\Controller\UnitTest\CorePersonRelationUnitTestController" ["Core\Controller\UnitTest\CorePhoneUnitTest"]=> string(52) "Core\Controller\UnitTest\CorePhoneUnitTestController" ["Core\Controller\UnitTest\CorePhoneTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CorePhoneTypeUnitTestController" ["Core\Controller\UnitTest\CoreRightUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreRightUnitTestController" ["Core\Controller\UnitTest\CoreRoleUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreRoleUnitTestController" ["Core\Controller\UnitTest\CoreRoleTypeUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreRoleTypeUnitTestController" ["Core\Controller\UnitTest\CoreTemplateUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreTemplateUnitTestController" ["Core\Controller\UnitTest\CoreTemplateGroupUnitTest"]=> string(60) "Core\Controller\UnitTest\CoreTemplateGroupUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreWebsiteUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreWebsiteTypeUnitTestController" ["QRCode\Controller\QRCode"]=> string(34) "QRCode\Controller\QRCodeController" ["QRCode\Controller\QRCodeAdmin"]=> string(39) "QRCode\Controller\QRCodeAdminController" ["QRCode\Controller\Access"]=> string(34) "QRCode\Controller\AccessController" ["QRCode\Controller\AccessAdmin"]=> string(39) "QRCode\Controller\AccessAdminController" ["Search\Controller\Search"]=> string(34) "Search\Controller\SearchController" ["Search\Controller\Index"]=> string(33) "Search\Controller\IndexController" ["Search\Controller\IndexAdmin"]=> string(38) "Search\Controller\IndexAdminController" } ["allowOverride":protected]=> bool(false) ["creationContext":protected]=> object(Laminas\ServiceManager\ServiceManager)#9 (14) { ["abstractFactories":protected]=> array(5) { ["0000000029a53fe8000000004b377aea"]=> object(Laminas\Cache\Service\StorageCacheAbstractServiceFactory)#573 (2) { ["config":protected]=> NULL ["configKey":protected]=> string(6) "caches" } ["0000000029a53feb000000004b377aea"]=> object(Laminas\Di\Container\ServiceManager\AutowireFactory)#574 (1) { ["factory":"Laminas\Di\Container\ServiceManager\AutowireFactory":private]=> object(Laminas\Di\Container\AutowireFactory)#575 (0) { } } ["0000000029a53f95000000004b377aea"]=> object(Laminas\Form\FormAbstractServiceFactory)#576 (3) { ["config":protected]=> NULL ["configKey":protected]=> string(5) "forms" ["factory":protected]=> NULL } ["0000000029a53f94000000004b377aea"]=> object(Laminas\Navigation\Service\NavigationAbstractServiceFactory)#577 (1) { ["config":protected]=> NULL } ["0000000029a53f97000000004b377aea"]=> object(Laminas\Db\Adapter\AdapterAbstractServiceFactory)#578 (1) { ["config":protected]=> NULL } } ["aliases":protected]=> array(275) { ["application"]=> string(11) "Application" ["Config"]=> string(6) "config" ["configuration"]=> string(6) "config" ["Configuration"]=> string(6) "config" ["HttpDefaultRenderingStrategy"]=> string(46) "Laminas\Mvc\View\Http\DefaultRenderingStrategy" ["MiddlewareListener"]=> string(30) "Laminas\Mvc\MiddlewareListener" ["request"]=> string(7) "Request" ["response"]=> string(8) "Response" ["RouteListener"]=> string(25) "Laminas\Mvc\RouteListener" ["SendResponseListener"]=> string(32) "Laminas\Mvc\SendResponseListener" ["View"]=> string(17) "Laminas\View\View" ["ViewFeedRenderer"]=> string(34) "Laminas\View\Renderer\FeedRenderer" ["ViewJsonRenderer"]=> string(34) "Laminas\View\Renderer\JsonRenderer" ["ViewPhpRendererStrategy"]=> string(41) "Laminas\View\Strategy\PhpRendererStrategy" ["ViewPhpRenderer"]=> string(33) "Laminas\View\Renderer\PhpRenderer" ["ViewRenderer"]=> string(33) "Laminas\View\Renderer\PhpRenderer" ["Laminas\Mvc\Controller\PluginManager"]=> string(23) "ControllerPluginManager" ["Laminas\Mvc\View\Http\InjectTemplateListener"]=> string(22) "InjectTemplateListener" ["Laminas\View\Renderer\RendererInterface"]=> string(33) "Laminas\View\Renderer\PhpRenderer" ["Laminas\View\Resolver\TemplateMapResolver"]=> string(23) "ViewTemplateMapResolver" ["Laminas\View\Resolver\TemplatePathStack"]=> string(21) "ViewTemplatePathStack" ["Laminas\View\Resolver\AggregateResolver"]=> string(12) "ViewResolver" ["Laminas\View\Resolver\ResolverInterface"]=> string(12) "ViewResolver" ["Laminas\Mvc\Controller\ControllerManager"]=> string(17) "ControllerManager" ["Zend\Di\InjectorInterface"]=> string(28) "Laminas\Di\InjectorInterface" ["Zend\Di\ConfigInterface"]=> string(26) "Laminas\Di\ConfigInterface" ["Zend\Di\CodeGenerator\InjectorGenerator"]=> string(42) "Laminas\Di\CodeGenerator\InjectorGenerator" ["MvcTranslator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["Zend\Mvc\I18n\Translator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["InputFilterManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["Zend\InputFilter\InputFilterPluginManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["HttpRouter"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["router"]=> string(34) "Laminas\Router\RouteStackInterface" ["Router"]=> string(34) "Laminas\Router\RouteStackInterface" ["RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\Http\TreeRouteStack"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["Zend\Router\RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\RouteStackInterface"]=> string(34) "Laminas\Router\RouteStackInterface" ["Laminas\Form\Annotation\AnnotationBuilder"]=> string(21) "FormAnnotationBuilder" ["Laminas\Form\Annotation\AttributeBuilder"]=> string(20) "FormAttributeBuilder" ["Laminas\Form\FormElementManager"]=> string(18) "FormElementManager" ["ValidatorManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Validator\ValidatorPluginManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Mail\Protocol\SmtpPluginManager"]=> string(39) "Laminas\Mail\Protocol\SmtpPluginManager" ["TranslatorPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["Zend\I18n\Translator\TranslatorInterface"]=> string(43) "Laminas\I18n\Translator\TranslatorInterface" ["Zend\I18n\Translator\LoaderPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Zend\Navigation\Navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Core\Interfaces\AddressManagerInterface"]=> string(34) "Core\Model\Services\AddressManager" ["Core\Interfaces\AddressDaoInterface"]=> string(25) "Core\Model\Dao\AddressDao" ["Core\Interfaces\AddressTypeManagerInterface"]=> string(38) "Core\Model\Services\AddressTypeManager" ["Core\Interfaces\AddressTypeDaoInterface"]=> string(29) "Core\Model\Dao\AddressTypeDao" ["Core\Interfaces\AjaxRightManagerInterface"]=> string(36) "Core\Model\Services\AjaxRightManager" ["Core\Interfaces\AjaxRightDaoInterface"]=> string(27) "Core\Model\Dao\AjaxRightDao" ["Core\Interfaces\BankManagerInterface"]=> string(31) "Core\Model\Services\BankManager" ["Core\Interfaces\BankDaoInterface"]=> string(22) "Core\Model\Dao\BankDao" ["Core\Interfaces\BankAccountManagerInterface"]=> string(38) "Core\Model\Services\BankAccountManager" ["Core\Interfaces\BankAccountDaoInterface"]=> string(29) "Core\Model\Dao\BankAccountDao" ["Core\Interfaces\BankAddressManagerInterface"]=> string(38) "Core\Model\Services\BankAddressManager" ["Core\Interfaces\BankAddressDaoInterface"]=> string(29) "Core\Model\Dao\BankAddressDao" ["Core\Interfaces\CertificateManagerInterface"]=> string(38) "Core\Model\Services\CertificateManager" ["Core\Interfaces\CertificateDaoInterface"]=> string(29) "Core\Model\Dao\CertificateDao" ["Core\Interfaces\ClosedDayManagerInterface"]=> string(36) "Core\Model\Services\ClosedDayManager" ["Core\Interfaces\ClosedDayDaoInterface"]=> string(27) "Core\Model\Dao\ClosedDayDao" ["Core\Interfaces\ClosedDayTypeManagerInterface"]=> string(40) "Core\Model\Services\ClosedDayTypeManager" ["Core\Interfaces\ClosedDayTypeDaoInterface"]=> string(31) "Core\Model\Dao\ClosedDayTypeDao" ["Core\Interfaces\CmsListManagerInterface"]=> string(34) "Core\Model\Services\CmsListManager" ["Core\Interfaces\CmsListDaoInterface"]=> string(25) "Core\Model\Dao\CmsListDao" ["Core\Interfaces\CmsListItemManagerInterface"]=> string(38) "Core\Model\Services\CmsListItemManager" ["Core\Interfaces\CmsListItemDaoInterface"]=> string(29) "Core\Model\Dao\CmsListItemDao" ["Core\Interfaces\ContentManagerInterface"]=> string(34) "Core\Model\Services\ContentManager" ["Core\Interfaces\ContentDaoInterface"]=> string(25) "Core\Model\Dao\ContentDao" ["Core\Interfaces\CmsObjectManagerInterface"]=> string(36) "Core\Model\Services\CmsObjectManager" ["Core\Interfaces\CmsObjectDaoInterface"]=> string(27) "Core\Model\Dao\CmsObjectDao" ["Core\Interfaces\CmsObjectTypeManagerInterface"]=> string(40) "Core\Model\Services\CmsObjectTypeManager" ["Core\Interfaces\CmsObjectTypeDaoInterface"]=> string(31) "Core\Model\Dao\CmsObjectTypeDao" ["Core\Interfaces\CmsObjectPropertyManagerInterface"]=> string(44) "Core\Model\Services\CmsObjectPropertyManager" ["Core\Interfaces\CmsObjectPropertyDaoInterface"]=> string(35) "Core\Model\Dao\CmsObjectPropertyDao" ["Core\Interfaces\CmsObjectPropertyTypeManagerInterface"]=> string(48) "Core\Model\Services\CmsObjectPropertyTypeManager" ["Core\Interfaces\CmsObjectPropertyTypeDaoInterface"]=> string(39) "Core\Model\Dao\CmsObjectPropertyTypeDao" ["Core\Interfaces\CmsUserManagerInterface"]=> string(34) "Core\Model\Services\CmsUserManager" ["Core\Interfaces\CmsUserDaoInterface"]=> string(25) "Core\Model\Dao\CmsUserDao" ["Core\Interfaces\ControllerActionManagerInterface"]=> string(43) "Core\Model\Services\ControllerActionManager" ["Core\Interfaces\ControllerActionDaoInterface"]=> string(34) "Core\Model\Dao\ControllerActionDao" ["Core\Interfaces\ControllerActionTemplateManagerInterface"]=> string(51) "Core\Model\Services\ControllerActionTemplateManager" ["Core\Interfaces\ControllerActionTemplateDaoInterface"]=> string(42) "Core\Model\Dao\ControllerActionTemplateDao" ["Core\Interfaces\CurrencyManagerInterface"]=> string(35) "Core\Model\Services\CurrencyManager" ["Core\Interfaces\CurrencyDaoInterface"]=> string(26) "Core\Model\Dao\CurrencyDao" ["Core\Interfaces\CityManagerInterface"]=> string(31) "Core\Model\Services\CityManager" ["Core\Interfaces\CityDaoInterface"]=> string(22) "Core\Model\Dao\CityDao" ["Core\Interfaces\ContinentManagerInterface"]=> string(36) "Core\Model\Services\ContinentManager" ["Core\Interfaces\ContinentDaoInterface"]=> string(27) "Core\Model\Dao\ContinentDao" ["Core\Interfaces\CountryManagerInterface"]=> string(34) "Core\Model\Services\CountryManager" ["Core\Interfaces\CountryDaoInterface"]=> string(25) "Core\Model\Dao\CountryDao" ["Core\Interfaces\DebugIpManagerInterface"]=> string(34) "Core\Model\Services\DebugIpManager" ["Core\Interfaces\DebugIpDaoInterface"]=> string(25) "Core\Model\Dao\DebugIpDao" ["Core\Interfaces\DeliveryTypeManagerInterface"]=> string(39) "Core\Model\Services\DeliveryTypeManager" ["Core\Interfaces\DeliveryTypeDaoInterface"]=> string(30) "Core\Model\Dao\DeliveryTypeDao" ["Core\Interfaces\EmailManagerInterface"]=> string(32) "Core\Model\Services\EmailManager" ["Core\Interfaces\EmailDaoInterface"]=> string(23) "Core\Model\Dao\EmailDao" ["Core\Interfaces\EmailMessageManagerInterface"]=> string(39) "Core\Model\Services\EmailMessageManager" ["Core\Interfaces\EmailMessageDaoInterface"]=> string(30) "Core\Model\Dao\EmailMessageDao" ["Core\Interfaces\EmailTypeManagerInterface"]=> string(36) "Core\Model\Services\EmailTypeManager" ["Core\Interfaces\EmailTypeDaoInterface"]=> string(27) "Core\Model\Dao\EmailTypeDao" ["Core\Interfaces\EntityRightManagerInterface"]=> string(38) "Core\Model\Services\EntityRightManager" ["Core\Interfaces\EntityRightDaoInterface"]=> string(29) "Core\Model\Dao\EntityRightDao" ["Core\Interfaces\ExtranetUserManagerInterface"]=> string(39) "Core\Model\Services\ExtranetUserManager" ["Core\Interfaces\ExtranetUserDaoInterface"]=> string(30) "Core\Model\Dao\ExtranetUserDao" ["Core\Interfaces\FormManagerInterface"]=> string(31) "Core\Model\Services\FormManager" ["Core\Interfaces\FormDaoInterface"]=> string(22) "Core\Model\Dao\FormDao" ["Core\Interfaces\FormFieldsetManagerInterface"]=> string(39) "Core\Model\Services\FormFieldsetManager" ["Core\Interfaces\FormFieldsetDaoInterface"]=> string(30) "Core\Model\Dao\FormFieldsetDao" ["Core\Interfaces\FormFieldManagerInterface"]=> string(36) "Core\Model\Services\FormFieldManager" ["Core\Interfaces\FormFieldDaoInterface"]=> string(27) "Core\Model\Dao\FormFieldDao" ["Core\Interfaces\LanguageManagerInterface"]=> string(35) "Core\Model\Services\LanguageManager" ["Core\Interfaces\LanguageDaoInterface"]=> string(26) "Core\Model\Dao\LanguageDao" ["Core\Interfaces\LibraryManagerInterface"]=> string(34) "Core\Model\Services\LibraryManager" ["Core\Interfaces\LibraryDaoInterface"]=> string(25) "Core\Model\Dao\LibraryDao" ["Core\Interfaces\LibraryTypeManagerInterface"]=> string(38) "Core\Model\Services\LibraryTypeManager" ["Core\Interfaces\LibraryTypeDaoInterface"]=> string(29) "Core\Model\Dao\LibraryTypeDao" ["Core\Interfaces\LibraryItemManagerInterface"]=> string(38) "Core\Model\Services\LibraryItemManager" ["Core\Interfaces\LibraryItemDaoInterface"]=> string(29) "Core\Model\Dao\LibraryItemDao" ["Core\Interfaces\LibraryItemTypeManagerInterface"]=> string(42) "Core\Model\Services\LibraryItemTypeManager" ["Core\Interfaces\LibraryItemTypeDaoInterface"]=> string(33) "Core\Model\Dao\LibraryItemTypeDao" ["Core\Interfaces\MessageManagerInterface"]=> string(34) "Core\Model\Services\MessageManager" ["Core\Interfaces\MessageDaoInterface"]=> string(25) "Core\Model\Dao\MessageDao" ["Core\Interfaces\ModuleManagerInterface"]=> string(33) "Core\Model\Services\ModuleManager" ["Core\Interfaces\ModuleDaoInterface"]=> string(24) "Core\Model\Dao\ModuleDao" ["Core\Interfaces\ModuleParameterManagerInterface"]=> string(42) "Core\Model\Services\ModuleParameterManager" ["Core\Interfaces\ModuleParameterDaoInterface"]=> string(33) "Core\Model\Dao\ModuleParameterDao" ["Core\Interfaces\PageManagerInterface"]=> string(31) "Core\Model\Services\PageManager" ["Core\Interfaces\PageDaoInterface"]=> string(22) "Core\Model\Dao\PageDao" ["Core\Interfaces\PersonManagerInterface"]=> string(33) "Core\Model\Services\PersonManager" ["Core\Interfaces\PersonDaoInterface"]=> string(24) "Core\Model\Dao\PersonDao" ["Core\Interfaces\PersonRelationManagerInterface"]=> string(41) "Core\Model\Services\PersonRelationManager" ["Core\Interfaces\PersonRelationDaoInterface"]=> string(32) "Core\Model\Dao\PersonRelationDao" ["Core\Interfaces\PhoneManagerInterface"]=> string(32) "Core\Model\Services\PhoneManager" ["Core\Interfaces\PhoneDaoInterface"]=> string(23) "Core\Model\Dao\PhoneDao" ["Core\Interfaces\PhoneTypeManagerInterface"]=> string(36) "Core\Model\Services\PhoneTypeManager" ["Core\Interfaces\PhoneTypeDaoInterface"]=> string(27) "Core\Model\Dao\PhoneTypeDao" ["Core\Interfaces\RightManagerInterface"]=> string(32) "Core\Model\Services\RightManager" ["Core\Interfaces\RightDaoInterface"]=> string(23) "Core\Model\Dao\RightDao" ["Core\Interfaces\RoleManagerInterface"]=> string(31) "Core\Model\Services\RoleManager" ["Core\Interfaces\RoleDaoInterface"]=> string(22) "Core\Model\Dao\RoleDao" ["Core\Interfaces\RoleTypeManagerInterface"]=> string(35) "Core\Model\Services\RoleTypeManager" ["Core\Interfaces\RoleTypeDaoInterface"]=> string(26) "Core\Model\Dao\RoleTypeDao" ["Core\Interfaces\RouteManagerInterface"]=> string(32) "Core\Model\Services\RouteManager" ["Core\Interfaces\RouteDaoInterface"]=> string(23) "Core\Model\Dao\RouteDao" ["Core\Interfaces\ShortUrlManagerInterface"]=> string(35) "Core\Model\Services\ShortUrlManager" ["Core\Interfaces\ShortUrlDaoInterface"]=> string(26) "Core\Model\Dao\ShortUrlDao" ["Core\Interfaces\SiteManagerInterface"]=> string(31) "Core\Model\Services\SiteManager" ["Core\Interfaces\SiteDaoInterface"]=> string(22) "Core\Model\Dao\SiteDao" ["Core\Interfaces\SiteDomainManagerInterface"]=> string(37) "Core\Model\Services\SiteDomainManager" ["Core\Interfaces\SiteDomainDaoInterface"]=> string(28) "Core\Model\Dao\SiteDomainDao" ["Core\Interfaces\StateManagerInterface"]=> string(32) "Core\Model\Services\StateManager" ["Core\Interfaces\StateDaoInterface"]=> string(23) "Core\Model\Dao\StateDao" ["Core\Interfaces\TemplateManagerInterface"]=> string(35) "Core\Model\Services\TemplateManager" ["Core\Interfaces\TemplateDaoInterface"]=> string(26) "Core\Model\Dao\TemplateDao" ["Core\Interfaces\TemplateGroupManagerInterface"]=> string(40) "Core\Model\Services\TemplateGroupManager" ["Core\Interfaces\TemplateGroupDaoInterface"]=> string(31) "Core\Model\Dao\TemplateGroupDao" ["Core\Interfaces\UserManagerInterface"]=> string(31) "Core\Model\Services\UserManager" ["Core\Interfaces\UserDaoInterface"]=> string(22) "Core\Model\Dao\UserDao" ["Core\Interfaces\UserSessionManagerInterface"]=> string(38) "Core\Model\Services\UserSessionManager" ["Core\Interfaces\UserSessionDaoInterface"]=> string(29) "Core\Model\Dao\UserSessionDao" ["Core\Interfaces\UserRoleManagerInterface"]=> string(35) "Core\Model\Services\UserRoleManager" ["Core\Interfaces\UserRoleDaoInterface"]=> string(26) "Core\Model\Dao\UserRoleDao" ["Core\Interfaces\UserFavoritObjectManagerInterface"]=> string(44) "Core\Model\Services\UserFavoritObjectManager" ["Core\Interfaces\UserFavoritObjectDaoInterface"]=> string(35) "Core\Model\Dao\UserFavoritObjectDao" ["Core\Interfaces\WebsiteManagerInterface"]=> string(34) "Core\Model\Services\WebsiteManager" ["Core\Interfaces\WebsiteDaoInterface"]=> string(25) "Core\Model\Dao\WebsiteDao" ["Core\Interfaces\WebsiteTypeManagerInterface"]=> string(38) "Core\Model\Services\WebsiteTypeManager" ["Core\Interfaces\WebsiteTypeDaoInterface"]=> string(29) "Core\Model\Dao\WebsiteTypeDao" ["Company\Interfaces\CompanyManagerInterface"]=> string(37) "Company\Model\Services\CompanyManager" ["Company\Interfaces\CompanyDaoInterface"]=> string(28) "Company\Model\Dao\CompanyDao" ["Company\Interfaces\DomainManagerInterface"]=> string(36) "Company\Model\Services\DomainManager" ["Company\Interfaces\DomainDaoInterface"]=> string(27) "Company\Model\Dao\DomainDao" ["Company\Interfaces\CompanyFunctionManagerInterface"]=> string(45) "Company\Model\Services\CompanyFunctionManager" ["Company\Interfaces\CompanyFunctionDaoInterface"]=> string(36) "Company\Model\Dao\CompanyFunctionDao" ["Company\Interfaces\EmployeeManagerInterface"]=> string(38) "Company\Model\Services\EmployeeManager" ["Company\Interfaces\EmployeeDaoInterface"]=> string(29) "Company\Model\Dao\EmployeeDao" ["Company\Interfaces\ContractManagerInterface"]=> string(38) "Company\Model\Services\ContractManager" ["Company\Interfaces\ContractDaoInterface"]=> string(29) "Company\Model\Dao\ContractDao" ["Company\Interfaces\ContractTypeManagerInterface"]=> string(42) "Company\Model\Services\ContractTypeManager" ["Company\Interfaces\ContractTypeDaoInterface"]=> string(33) "Company\Model\Dao\ContractTypeDao" ["Contact\Interfaces\ContactManagerInterface"]=> string(37) "Contact\Model\Services\ContactManager" ["Contact\Interfaces\ContactDaoInterface"]=> string(28) "Contact\Model\Dao\ContactDao" ["Contact\Interfaces\ContactAnswerManagerInterface"]=> string(43) "Contact\Model\Services\ContactAnswerManager" ["Contact\Interfaces\ContactAnswerDaoInterface"]=> string(34) "Contact\Model\Dao\ContactAnswerDao" ["Contact\Interfaces\ContactCommentManagerInterface"]=> string(44) "Contact\Model\Services\ContactCommentManager" ["Contact\Interfaces\ContactCommentDaoInterface"]=> string(35) "Contact\Model\Dao\ContactCommentDao" ["Contact\Interfaces\ContactStatusManagerInterface"]=> string(43) "Contact\Model\Services\ContactStatusManager" ["Contact\Interfaces\ContactStatusDaoInterface"]=> string(34) "Contact\Model\Dao\ContactStatusDao" ["Galleries\Interfaces\GalleryManagerInterface"]=> string(39) "Galleries\Model\Services\GalleryManager" ["Galleries\Interfaces\GalleryDaoInterface"]=> string(30) "Galleries\Model\Dao\GalleryDao" ["Galleries\Interfaces\ItemManagerInterface"]=> string(36) "Galleries\Model\Services\ItemManager" ["Galleries\Interfaces\ItemDaoInterface"]=> string(27) "Galleries\Model\Dao\ItemDao" ["Galleries\Interfaces\ItemTypeManagerInterface"]=> string(40) "Galleries\Model\Services\ItemTypeManager" ["Galleries\Interfaces\ItemTypeDaoInterface"]=> string(31) "Galleries\Model\Dao\ItemTypeDao" ["Galleries\Interfaces\ItemCommentManagerInterface"]=> string(43) "Galleries\Model\Services\ItemCommentManager" ["Galleries\Interfaces\ItemCommentDaoInterface"]=> string(34) "Galleries\Model\Dao\ItemCommentDao" ["Logs\Interfaces\LogManagerInterface"]=> string(30) "Logs\Model\Services\LogManager" ["Logs\Interfaces\LogDaoInterface"]=> string(21) "Logs\Model\Dao\LogDao" ["Menu\Interfaces\MenuManagerInterface"]=> string(31) "Menu\Model\Services\MenuManager" ["Menu\Interfaces\MenuDaoInterface"]=> string(22) "Menu\Model\Dao\MenuDao" ["Menu\Interfaces\MenuItemManagerInterface"]=> string(35) "Menu\Model\Services\MenuItemManager" ["Menu\Interfaces\MenuItemDaoInterface"]=> string(26) "Menu\Model\Dao\MenuItemDao" ["Widget\Interfaces\WidgetManagerInterface"]=> string(35) "Widget\Model\Services\WidgetManager" ["Widget\Interfaces\WidgetDaoInterface"]=> string(26) "Widget\Model\Dao\WidgetDao" ["Widget\Interfaces\WidgetPositionManagerInterface"]=> string(43) "Widget\Model\Services\WidgetPositionManager" ["Widget\Interfaces\WidgetPositionDaoInterface"]=> string(34) "Widget\Model\Dao\WidgetPositionDao" ["Products\Interfaces\ProductManagerInterface"]=> string(38) "Products\Model\Services\ProductManager" ["Products\Interfaces\ProductDaoInterface"]=> string(29) "Products\Model\Dao\ProductDao" ["Products\Interfaces\CategoryManagerInterface"]=> string(39) "Products\Model\Services\CategoryManager" ["Products\Interfaces\CategoryDaoInterface"]=> string(30) "Products\Model\Dao\CategoryDao" ["Products\Interfaces\ProductTypeManagerInterface"]=> string(42) "Products\Model\Services\ProductTypeManager" ["Products\Interfaces\ProductTypeDaoInterface"]=> string(33) "Products\Model\Dao\ProductTypeDao" ["Products\Interfaces\BrandManagerInterface"]=> string(36) "Products\Model\Services\BrandManager" ["Products\Interfaces\BrandDaoInterface"]=> string(27) "Products\Model\Dao\BrandDao" ["Products\Interfaces\CriteriaManagerInterface"]=> string(39) "Products\Model\Services\CriteriaManager" ["Products\Interfaces\CriteriaDaoInterface"]=> string(30) "Products\Model\Dao\CriteriaDao" ["Shop\Interfaces\ShopManagerInterface"]=> string(31) "Shop\Model\Services\ShopManager" ["Shop\Interfaces\ShopDaoInterface"]=> string(22) "Shop\Model\Dao\ShopDao" ["Shop\Interfaces\ShopProductManagerInterface"]=> string(38) "Shop\Model\Services\ShopProductManager" ["Shop\Interfaces\ShopProductDaoInterface"]=> string(29) "Shop\Model\Dao\ShopProductDao" ["Shop\Interfaces\CategoryManagerInterface"]=> string(35) "Shop\Model\Services\CategoryManager" ["Shop\Interfaces\CategoryDaoInterface"]=> string(26) "Shop\Model\Dao\CategoryDao" ["Shop\Interfaces\OrderManagerInterface"]=> string(32) "Shop\Model\Services\OrderManager" ["Shop\Interfaces\OrderDaoInterface"]=> string(23) "Shop\Model\Dao\OrderDao" ["Shop\Interfaces\OrderItemManagerInterface"]=> string(36) "Shop\Model\Services\OrderItemManager" ["Shop\Interfaces\OrderItemDaoInterface"]=> string(27) "Shop\Model\Dao\OrderItemDao" ["Shop\Interfaces\TaxManagerInterface"]=> string(30) "Shop\Model\Services\TaxManager" ["Shop\Interfaces\TaxDaoInterface"]=> string(21) "Shop\Model\Dao\TaxDao" ["Shop\Interfaces\TaxGroupManagerInterface"]=> string(35) "Shop\Model\Services\TaxGroupManager" ["Shop\Interfaces\TaxGroupDaoInterface"]=> string(26) "Shop\Model\Dao\TaxGroupDao" ["Shop\Interfaces\TaxRuleManagerInterface"]=> string(34) "Shop\Model\Services\TaxRuleManager" ["Shop\Interfaces\TaxRuleDaoInterface"]=> string(25) "Shop\Model\Dao\TaxRuleDao" ["Shop\Interfaces\PriceTableManagerInterface"]=> string(37) "Shop\Model\Services\PriceTableManager" ["Shop\Interfaces\PriceTableDaoInterface"]=> string(28) "Shop\Model\Dao\PriceTableDao" ["Shop\Interfaces\PriceTableConditionnementManagerInterface"]=> string(52) "Shop\Model\Services\PriceTableConditionnementManager" ["Shop\Interfaces\PriceTableConditionnementDaoInterface"]=> string(43) "Shop\Model\Dao\PriceTableConditionnementDao" ["Shop\Interfaces\WishListManagerInterface"]=> string(35) "Shop\Model\Services\WishListManager" ["Shop\Interfaces\WishListDaoInterface"]=> string(26) "Shop\Model\Dao\WishListDao" ["Shop\Interfaces\PromotionManagerInterface"]=> string(36) "Shop\Model\Services\PromotionManager" ["Shop\Interfaces\PromotionDaoInterface"]=> string(27) "Shop\Model\Dao\PromotionDao" ["Shop\Interfaces\PromotionItemManagerInterface"]=> string(40) "Shop\Model\Services\PromotionItemManager" ["Shop\Interfaces\PromotionItemDaoInterface"]=> string(31) "Shop\Model\Dao\PromotionItemDao" ["Shop\Interfaces\CartManagerInterface"]=> string(31) "Shop\Model\Services\CartManager" ["Shop\Interfaces\CartDaoInterface"]=> string(22) "Shop\Model\Dao\CartDao" ["Shop\Interfaces\CartItemManagerInterface"]=> string(35) "Shop\Model\Services\CartItemManager" ["Shop\Interfaces\CartItemDaoInterface"]=> string(26) "Shop\Model\Dao\CartItemDao" ["Shop\Interfaces\CartConstraintManagerInterface"]=> string(41) "Shop\Model\Services\CartConstraintManager" ["Shop\Interfaces\CartConstraintDaoInterface"]=> string(32) "Shop\Model\Dao\CartConstraintDao" ["Shop\Interfaces\CartRuleManagerInterface"]=> string(35) "Shop\Model\Services\CartRuleManager" ["Shop\Interfaces\CartRuleDaoInterface"]=> string(26) "Shop\Model\Dao\CartRuleDao" ["Shop\Interfaces\CartRuleRestrictionManagerInterface"]=> string(46) "Shop\Model\Services\CartRuleRestrictionManager" ["Shop\Interfaces\CartRuleRestrictionDaoInterface"]=> string(37) "Shop\Model\Dao\CartRuleRestrictionDao" ["Shop\Interfaces\OrderCartRuleManagerInterface"]=> string(40) "Shop\Model\Services\OrderCartRuleManager" ["Shop\Interfaces\OrderCartRuleDaoInterface"]=> string(31) "Shop\Model\Dao\OrderCartRuleDao" ["Shop\Interfaces\OrderCartRuleRestrictionManagerInterface"]=> string(51) "Shop\Model\Services\OrderCartRuleRestrictionManager" ["Shop\Interfaces\OrderCartRuleRestrictionDaoInterface"]=> string(42) "Shop\Model\Dao\OrderCartRuleRestrictionDao" ["Payments\Interfaces\PaymentManagerInterface"]=> string(38) "Payments\Model\Services\PaymentManager" ["Payments\Interfaces\PaymentDaoInterface"]=> string(29) "Payments\Model\Dao\PaymentDao" ["Payments\Interfaces\PaymentTypeManagerInterface"]=> string(42) "Payments\Model\Services\PaymentTypeManager" ["Payments\Interfaces\PaymentTypeDaoInterface"]=> string(33) "Payments\Model\Dao\PaymentTypeDao" ["Testimonials\Interfaces\TestimonialManagerInterface"]=> string(46) "Testimonials\Model\Services\TestimonialManager" ["Testimonials\Interfaces\TestimonialDaoInterface"]=> string(37) "Testimonials\Model\Dao\TestimonialDao" ["Checkout\Interfaces\PaymentManagerInterface"]=> string(38) "Checkout\Model\Services\PaymentManager" ["EventManagerInterface"]=> string(33) "Laminas\EventManager\EventManager" ["Laminas\EventManager\EventManagerInterface"]=> string(12) "EventManager" ["Laminas\ModuleManager\ModuleManager"]=> string(13) "ModuleManager" ["Laminas\ModuleManager\Listener\ServiceListener"]=> string(15) "ServiceListener" ["Laminas\EventManager\SharedEventManager"]=> string(18) "SharedEventManager" ["SharedEventManagerInterface"]=> string(18) "SharedEventManager" ["Laminas\EventManager\SharedEventManagerInterface"]=> string(18) "SharedEventManager" } ["allowOverride":protected]=> bool(false) ["creationContext":protected]=> *RECURSION* ["delegators":protected]=> array(4) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> array(2) { [0]=> object(Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory)#1110 (0) { } [1]=> object(Laminas\Cache\Storage\Adapter\BlackHole\AdapterPluginManagerDelegatorFactory)#1115 (0) { } } ["HttpRouter"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["Laminas\Router\Http\TreeRouteStack"]=> array(1) { [0]=> object(Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory)#1220 (0) { } } ["ViewHelperManager"]=> array(1) { [0]=> object(Laminas\Navigation\View\ViewHelperManagerDelegatorFactory)#584 (0) { } } } ["factories":protected]=> array(788) { ["Application"]=> object(Laminas\Mvc\Service\ApplicationFactory)#12 (0) { } ["config"]=> object(Laminas\Mvc\Service\ConfigFactory)#592 (0) { } ["ControllerManager"]=> object(Laminas\Mvc\Service\ControllerManagerFactory)#579 (0) { } ["ControllerPluginManager"]=> object(Laminas\Mvc\Service\ControllerPluginManagerFactory)#564 (0) { } ["DispatchListener"]=> object(Laminas\Mvc\Service\DispatchListenerFactory)#2316 (0) { } ["HttpExceptionStrategy"]=> object(Laminas\Mvc\Service\HttpExceptionStrategyFactory)#2334 (0) { } ["HttpMethodListener"]=> object(Laminas\Mvc\Service\HttpMethodListenerFactory)#2318 (0) { } ["HttpRouteNotFoundStrategy"]=> object(Laminas\Mvc\Service\HttpRouteNotFoundStrategyFactory)#2332 (0) { } ["HttpViewManager"]=> object(Laminas\Mvc\Service\HttpViewManagerFactory)#2321 (0) { } ["InjectTemplateListener"]=> object(Laminas\Mvc\Service\InjectTemplateListenerFactory)#2364 (0) { } ["PaginatorPluginManager"]=> string(49) "Laminas\Mvc\Service\PaginatorPluginManagerFactory" ["Request"]=> object(Laminas\Mvc\Service\RequestFactory)#604 (0) { } ["Response"]=> object(Laminas\Mvc\Service\ResponseFactory)#2310 (0) { } ["ViewHelperManager"]=> object(Laminas\Mvc\Service\ViewHelperManagerFactory)#586 (1) { ["defaultHelperMapClasses":protected]=> array(0) { } } ["Laminas\Mvc\View\Http\DefaultRenderingStrategy"]=> object(Laminas\Mvc\Service\HttpDefaultRenderingStrategyFactory)#2336 (0) { } ["ViewFeedStrategy"]=> string(43) "Laminas\Mvc\Service\ViewFeedStrategyFactory" ["ViewJsonStrategy"]=> object(Laminas\Mvc\Service\ViewJsonStrategyFactory)#2368 (0) { } ["ViewManager"]=> object(Laminas\Mvc\Service\ViewManagerFactory)#2320 (0) { } ["ViewResolver"]=> object(Laminas\Mvc\Service\ViewResolverFactory)#2346 (0) { } ["ViewTemplateMapResolver"]=> object(Laminas\Mvc\Service\ViewTemplateMapResolverFactory)#2349 (0) { } ["ViewTemplatePathStack"]=> object(Laminas\Mvc\Service\ViewTemplatePathStackFactory)#2351 (0) { } ["ViewPrefixPathStackResolver"]=> object(Laminas\Mvc\Service\ViewPrefixPathStackResolverFactory)#2354 (0) { } ["Laminas\Mvc\MiddlewareListener"]=> object(Laminas\ServiceManager\Factory\InvokableFactory)#2314 (0) { } ["Laminas\Mvc\RouteListener"]=> object(Laminas\ServiceManager\Factory\InvokableFactory)#2312 (0) { } ["Laminas\Mvc\SendResponseListener"]=> object(Laminas\Mvc\Service\SendResponseListenerFactory)#2323 (0) { } ["Laminas\View\Renderer\FeedRenderer"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\View\Renderer\JsonRenderer"]=> object(Laminas\ServiceManager\Factory\InvokableFactory)#2369 (0) { } ["Laminas\View\Renderer\PhpRenderer"]=> object(Laminas\Mvc\Service\ViewPhpRendererFactory)#2344 (0) { } ["Laminas\View\Strategy\PhpRendererStrategy"]=> object(Laminas\Mvc\Service\ViewPhpRendererStrategyFactory)#2342 (0) { } ["Laminas\View\View"]=> object(Laminas\Mvc\Service\ViewFactory)#2338 (0) { } ["Core\Admin\Form\AddressForm"]=> object(Closure)#52 (2) { ["this"]=> object(Core\Module)#50 (11) { ["defaultAdminLanguage":"Core\Module":private]=> string(2) "fr" ["requestedCmsObject":"Core\Module":private]=> object(Core\Model\Domain\CmsObject)#1164 (30) { ["objectId"]=> string(25) "EN_549296cbd43ea385133062" ["parentObjectId"]=> string(25) "EN_548aaba3ef08d749124007" ["objectTypeId"]=> string(1) "2" ["lngUnId"]=> string(22) "549296cbd43ea385133062" ["languageId"]=> string(2) "42" ["siteId"]=> string(1) "1" ["templateId"]=> string(2) "43" ["templateGroupId"]=> string(1) "1" ["last"]=> int(1) ["version"]=> int(1) ["active"]=> int(1) ["url"]=> string(0) "" ["status"]=> int(2) ["statusUserId"]=> string(1) "0" ["deleted"]=> int(0) ["deletedBy"]=> string(1) "0" ["published"]=> int(1) ["publishedBy"]=> string(1) "1" ["creationDate"]=> string(19) "2014-12-18 09:56:43" ["createdBy"]=> string(1) "1" ["updateDate"]=> string(19) "2014-12-18 09:56:43" ["updatedBy"]=> string(1) "1" ["publicationDateFrom"]=> string(19) "0000-00-00 00:00:00" ["publicationDateTo"]=> string(19) "0000-00-00 00:00:00" ["owner"]=> string(1) "1" ["displayOrder"]=> int(0) ["objectUrl"]=> NULL ["objectsFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } ["fieldsMap":protected]=> array(27) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" ["objectUrl"]=> string(10) "object_url" } ["localFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } } ["requestedObject":"Core\Module":private]=> NULL ["requestServerData":"Core\Module":private]=> object(Laminas\Stdlib\Parameters)#610 (1) { ["storage":"ArrayObject":private]=> array(62) { ["TEMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMPDIR"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["ORIG_SCRIPT_NAME"]=> string(19) "/.fpm/php5.external" ["ORIG_PATH_TRANSLATED"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["ORIG_PATH_INFO"]=> string(17) "/public/index.php" ["ORIG_SCRIPT_FILENAME"]=> string(105) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/php5.external" ["SCRIPT_NAME"]=> string(17) "/public/index.php" ["REQUEST_URI"]=> string(58) "/en/shop/detailsen?id=6253d9fcc47bc657111855&catname=wines" ["QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REQUEST_METHOD"]=> string(3) "GET" ["SERVER_PROTOCOL"]=> string(8) "HTTP/1.1" ["GATEWAY_INTERFACE"]=> string(7) "CGI/1.1" ["REDIRECT_QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REDIRECT_URL"]=> string(17) "/public/index.php" ["REMOTE_PORT"]=> string(5) "58056" ["SCRIPT_FILENAME"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["SERVER_ADMIN"]=> string(30) "webmaster@chateau-auvernier.ch" ["CONTEXT_DOCUMENT_ROOT"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/" ["CONTEXT_PREFIX"]=> string(6) "/.fpm/" ["REQUEST_SCHEME"]=> string(5) "https" ["DOCUMENT_ROOT"]=> string(77) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch" ["REMOTE_ADDR"]=> string(33) "2001:1600:4:b:1a66:daff:fe53:6382" ["SERVER_PORT"]=> string(3) "443" ["SERVER_ADDR"]=> string(10) "" ["SERVER_NAME"]=> string(20) "chateau-auvernier.ch" ["SERVER_SOFTWARE"]=> string(6) "Apache" ["SERVER_SIGNATURE"]=> string(0) "" ["PATH"]=> string(60) "/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin" ["HTTP_X_FORWARDED_PROTO"]=> string(5) "https" ["HTTP_CONNECTION"]=> string(5) "close" ["HTTP_X_FORWARDED_SERVER"]=> string(24) "new.chateau-auvernier.ch" ["HTTP_X_FORWARDED_HOST"]=> string(20) "chateau-auvernier.ch" ["HTTP_X_FORWARDED_FOR"]=> string(12) "" ["HTTP_ACCEPT_ENCODING"]=> string(7) "br,gzip" ["HTTP_ACCEPT_LANGUAGE"]=> string(14) "en-US,en;q=0.5" ["HTTP_ACCEPT"]=> string(63) "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8" ["HTTP_USER_AGENT"]=> string(40) "CCBot/2.0 (https://commoncrawl.org/faq/)" ["HTTP_HOST"]=> string(20) "chateau-auvernier.ch" ["PHP_VERSION"]=> string(3) "8.0" ["SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["HTTPS"]=> string(2) "on" ["UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_HANDLER"]=> string(9) "php5-fcgi" ["REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_REDIRECT_proto"]=> string(5) "https" ["REDIRECT_REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["FCGI_ROLE"]=> string(9) "RESPONDER" ["PHP_SELF"]=> string(17) "/public/index.php" ["REQUEST_TIME_FLOAT"]=> float(1656950269.863278) ["REQUEST_TIME"]=> int(1656950269) } } ["config":"Core\Module":private]=> array(45) { ["service_manager"]=> array(4) { ["abstract_factories"]=> array(6) { [0]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [1]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [2]=> string(51) "Laminas\Di\Container\ServiceManager\AutowireFactory" [3]=> string(39) "Laminas\Form\FormAbstractServiceFactory" [4]=> string(59) "Laminas\Navigation\Service\NavigationAbstractServiceFactory" [5]=> string(48) "Laminas\Db\Adapter\AdapterAbstractServiceFactory" } ["factories"]=> array(401) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> string(56) "Laminas\Cache\Service\StorageAdapterPluginManagerFactory" ["Laminas\Cache\Storage\PluginManager"]=> string(49) "Laminas\Cache\Service\StoragePluginManagerFactory" ["Laminas\Cache\Service\StoragePluginFactory"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StoragePluginFactoryInterface"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactory"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactoryInterface"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Di\InjectorInterface"]=> string(36) "Laminas\Di\Container\InjectorFactory" ["Laminas\Di\ConfigInterface"]=> string(34) "Laminas\Di\Container\ConfigFactory" ["Laminas\Di\CodeGenerator\InjectorGenerator"]=> string(37) "Laminas\Di\Container\GeneratorFactory" ["Laminas\Mvc\I18n\Translator"]=> string(34) "Laminas\Mvc\I18n\TranslatorFactory" ["Laminas\InputFilter\InputFilterPluginManager"]=> string(51) "Laminas\InputFilter\InputFilterPluginManagerFactory" ["SerializerAdapterManager"]=> string(46) "Laminas\Serializer\AdapterPluginManagerFactory" ["Laminas\Router\Http\TreeRouteStack"]=> string(37) "Laminas\Router\Http\HttpRouterFactory" ["Laminas\Router\RoutePluginManager"]=> string(40) "Laminas\Router\RoutePluginManagerFactory" ["Laminas\Router\RouteStackInterface"]=> string(28) "Laminas\Router\RouterFactory" ["FormAnnotationBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormAttributeBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormElementManager"]=> string(38) "Laminas\Form\FormElementManagerFactory" ["Laminas\Validator\ValidatorPluginManager"]=> string(47) "Laminas\Validator\ValidatorPluginManagerFactory" ["Laminas\Mail\Protocol\SmtpPluginManager"]=> string(46) "Laminas\Mail\Protocol\SmtpPluginManagerFactory" ["Laminas\I18n\Translator\TranslatorInterface"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["Laminas\I18n\Translator\LoaderPluginManager"]=> string(50) "Laminas\I18n\Translator\LoaderPluginManagerFactory" ["Laminas\Navigation\Navigation"]=> string(51) "Laminas\Navigation\Service\DefaultNavigationFactory" ["main-navigation"]=> string(34) "Core\Factory\MainNavigationFactory" ["admin-navigation"]=> string(39) "Core\Factory\AdminMainNavigationFactory" ["translator"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["CoreManager"]=> string(39) "Core\Factory\Manager\CoreManagerFactory" ["Core\Model\Services\ControllerActionManagerLaminas"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDaoLaminas"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["ControllerActionGatewayLaminas"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\PageManagerLaminas"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDaoLaminas"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["PageGatewayLaminas"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\CmsObjectManager"]=> string(44) "Core\Factory\Manager\CmsObjectManagerFactory" ["Core\Model\Dao\CmsObjectDao"]=> string(36) "Core\Factory\Dao\CmsObjectDaoFactory" ["CmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\AddressManager"]=> string(42) "Core\Factory\Manager\AddressManagerFactory" ["Core\Model\Dao\AddressDao"]=> string(34) "Core\Factory\Dao\AddressDaoFactory" ["CoreAddressGateway"]=> string(42) "Core\Factory\Gateway\AddressGatewayFactory" ["Core\Model\Services\AddressTypeManager"]=> string(46) "Core\Factory\Manager\AddressTypeManagerFactory" ["Core\Model\Dao\AddressTypeDao"]=> string(38) "Core\Factory\Dao\AddressTypeDaoFactory" ["CoreAddressTypeGateway"]=> string(46) "Core\Factory\Gateway\AddressTypeGatewayFactory" ["Core\Model\Services\AjaxRightManager"]=> string(44) "Core\Factory\Manager\AjaxRightManagerFactory" ["Core\Model\Dao\AjaxRightDao"]=> string(36) "Core\Factory\Dao\AjaxRightDaoFactory" ["CoreAjaxRightGateway"]=> string(44) "Core\Factory\Gateway\AjaxRightGatewayFactory" ["Core\Model\Services\BankManager"]=> string(39) "Core\Factory\Manager\BankManagerFactory" ["Core\Model\Dao\BankDao"]=> string(31) "Core\Factory\Dao\BankDaoFactory" ["CoreBankGateway"]=> string(39) "Core\Factory\Gateway\BankGatewayFactory" ["Core\Model\Services\BankAccountManager"]=> string(46) "Core\Factory\Manager\BankAccountManagerFactory" ["Core\Model\Dao\BankAccountDao"]=> string(38) "Core\Factory\Dao\BankAccountDaoFactory" ["CoreBankAccountGateway"]=> string(46) "Core\Factory\Gateway\BankAccountGatewayFactory" ["Core\Model\Services\BankAddressManager"]=> string(46) "Core\Factory\Manager\BankAddressManagerFactory" ["Core\Model\Dao\BankAddressDao"]=> string(38) "Core\Factory\Dao\BankAddressDaoFactory" ["CoreBankAddressGateway"]=> string(46) "Core\Factory\Gateway\BankAddressGatewayFactory" ["Core\Model\Services\CertificateManager"]=> string(46) "Core\Factory\Manager\CertificateManagerFactory" ["Core\Model\Dao\CertificateDao"]=> string(38) "Core\Factory\Dao\CertificateDaoFactory" ["CoreCertificateGateway"]=> string(46) "Core\Factory\Gateway\CertificateGatewayFactory" ["Core\Model\Services\ClosedDayManager"]=> string(44) "Core\Factory\Manager\ClosedDayManagerFactory" ["Core\Model\Dao\ClosedDayDao"]=> string(36) "Core\Factory\Dao\ClosedDayDaoFactory" ["CoreClosedDayGateway"]=> string(44) "Core\Factory\Gateway\ClosedDayGatewayFactory" ["Core\Model\Services\ClosedDayTypeManager"]=> string(48) "Core\Factory\Manager\ClosedDayTypeManagerFactory" ["Core\Model\Dao\ClosedDayTypeDao"]=> string(40) "Core\Factory\Dao\ClosedDayTypeDaoFactory" ["CoreClosedDayTypeGateway"]=> string(48) "Core\Factory\Gateway\ClosedDayTypeGatewayFactory" ["Core\Model\Services\CmsListManager"]=> string(42) "Core\Factory\Manager\CmsListManagerFactory" ["Core\Model\Dao\CmsListDao"]=> string(34) "Core\Factory\Dao\CmsListDaoFactory" ["CoreCmsListGateway"]=> string(42) "Core\Factory\Gateway\CmsListGatewayFactory" ["Core\Model\Services\CmsListItemManager"]=> string(46) "Core\Factory\Manager\CmsListItemManagerFactory" ["Core\Model\Dao\CmsListItemDao"]=> string(38) "Core\Factory\Dao\CmsListItemDaoFactory" ["CoreCmsListItemGateway"]=> string(46) "Core\Factory\Gateway\CmsListItemGatewayFactory" ["Core\Model\Services\ContentManager"]=> string(42) "Core\Factory\Manager\ContentManagerFactory" ["Core\Model\Dao\ContentDao"]=> string(34) "Core\Factory\Dao\ContentDaoFactory" ["CoreContentGateway"]=> string(42) "Core\Factory\Gateway\ContentGatewayFactory" ["CoreCmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["Core\Model\Services\CmsObjectTypeManager"]=> string(48) "Core\Factory\Manager\CmsObjectTypeManagerFactory" ["Core\Model\Dao\CmsObjectTypeDao"]=> string(40) "Core\Factory\Dao\CmsObjectTypeDaoFactory" ["CoreCmsObjectTypeGateway"]=> string(48) "Core\Factory\Gateway\CmsObjectTypeGatewayFactory" ["Core\Model\Services\CmsObjectPropertyManager"]=> string(52) "Core\Factory\Manager\CmsObjectPropertyManagerFactory" ["Core\Model\Dao\CmsObjectPropertyDao"]=> string(44) "Core\Factory\Dao\CmsObjectPropertyDaoFactory" ["CoreCmsObjectPropertyGateway"]=> string(52) "Core\Factory\Gateway\CmsObjectPropertyGatewayFactory" ["Core\Model\Services\CmsObjectPropertyTypeManager"]=> string(56) "Core\Factory\Manager\CmsObjectPropertyTypeManagerFactory" ["Core\Model\Dao\CmsObjectPropertyTypeDao"]=> string(48) "Core\Factory\Dao\CmsObjectPropertyTypeDaoFactory" ["CoreCmsObjectPropertyTypeGateway"]=> string(56) "Core\Factory\Gateway\CmsObjectPropertyTypeGatewayFactory" ["Core\Model\Services\ControllerActionManager"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDao"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["CoreControllerActionGateway"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\ControllerActionTemplateManager"]=> string(59) "Core\Factory\Manager\ControllerActionTemplateManagerFactory" ["Core\Model\Dao\ControllerActionTemplateDao"]=> string(51) "Core\Factory\Dao\ControllerActionTemplateDaoFactory" ["CoreControllerActionTemplateGateway"]=> string(59) "Core\Factory\Gateway\ControllerActionTemplateGatewayFactory" ["Core\Model\Services\CurrencyManager"]=> string(43) "Core\Factory\Manager\CurrencyManagerFactory" ["Core\Model\Dao\CurrencyDao"]=> string(35) "Core\Factory\Dao\CurrencyDaoFactory" ["CoreCurrencyGateway"]=> string(43) "Core\Factory\Gateway\CurrencyGatewayFactory" ["Core\Model\Services\CityManager"]=> string(39) "Core\Factory\Manager\CityManagerFactory" ["Core\Model\Dao\CityDao"]=> string(31) "Core\Factory\Dao\CityDaoFactory" ["CoreCityGateway"]=> string(39) "Core\Factory\Gateway\CityGatewayFactory" ["Core\Model\Services\CmsUserManager"]=> string(42) "Core\Factory\Manager\CmsUserManagerFactory" ["Core\Model\Dao\CmsUserDao"]=> string(34) "Core\Factory\Dao\CmsUserDaoFactory" ["CoreCmsUserGateway"]=> string(42) "Core\Factory\Gateway\CmsUserGatewayFactory" ["Core\Model\Services\ContinentManager"]=> string(44) "Core\Factory\Manager\ContinentManagerFactory" ["Core\Model\Dao\ContinentDao"]=> string(36) "Core\Factory\Dao\ContinentDaoFactory" ["CoreContinentGateway"]=> string(44) "Core\Factory\Gateway\ContinentGatewayFactory" ["Core\Model\Services\CountryManager"]=> string(42) "Core\Factory\Manager\CountryManagerFactory" ["Core\Model\Dao\CountryDao"]=> string(34) "Core\Factory\Dao\CountryDaoFactory" ["CoreCountryGateway"]=> string(42) "Core\Factory\Gateway\CountryGatewayFactory" ["Core\Model\Services\DebugIpManager"]=> string(42) "Core\Factory\Manager\DebugIpManagerFactory" ["Core\Model\Dao\DebugIpDao"]=> string(34) "Core\Factory\Dao\DebugIpDaoFactory" ["CoreDebugIpGateway"]=> string(42) "Core\Factory\Gateway\DebugIpGatewayFactory" ["Core\Model\Services\DeliveryTypeManager"]=> string(47) "Core\Factory\Manager\DeliveryTypeManagerFactory" ["Core\Model\Dao\DeliveryTypeDao"]=> string(39) "Core\Factory\Dao\DeliveryTypeDaoFactory" ["CoreDeliveryTypeGateway"]=> string(47) "Core\Factory\Gateway\DeliveryTypeGatewayFactory" ["Core\Model\Services\EmailManager"]=> string(40) "Core\Factory\Manager\EmailManagerFactory" ["Core\Model\Dao\EmailDao"]=> string(32) "Core\Factory\Dao\EmailDaoFactory" ["CoreEmailGateway"]=> string(40) "Core\Factory\Gateway\EmailGatewayFactory" ["Core\Model\Services\EmailMessageManager"]=> string(47) "Core\Factory\Manager\EmailMessageManagerFactory" ["Core\Model\Dao\EmailMessageDao"]=> string(39) "Core\Factory\Dao\EmailMessageDaoFactory" ["CoreEmailMessageGateway"]=> string(47) "Core\Factory\Gateway\EmailMessageGatewayFactory" ["Core\Model\Services\EmailTypeManager"]=> string(44) "Core\Factory\Manager\EmailTypeManagerFactory" ["Core\Model\Dao\EmailTypeDao"]=> string(36) "Core\Factory\Dao\EmailTypeDaoFactory" ["CoreEmailTypeGateway"]=> string(44) "Core\Factory\Gateway\EmailTypeGatewayFactory" ["Core\Model\Services\EntityRightManager"]=> string(46) "Core\Factory\Manager\EntityRightManagerFactory" ["Core\Model\Dao\EntityRightDao"]=> string(38) "Core\Factory\Dao\EntityRightDaoFactory" ["CoreEntityRightGateway"]=> string(46) "Core\Factory\Gateway\EntityRightGatewayFactory" ["Core\Model\Services\ExtranetUserManager"]=> string(47) "Core\Factory\Manager\ExtranetUserManagerFactory" ["Core\Model\Dao\ExtranetUserDao"]=> string(39) "Shop\Factory\Dao\ExtranetUserDaoFactory" ["CoreExtranetUserGateway"]=> string(47) "Core\Factory\Gateway\ExtranetUserGatewayFactory" ["Core\Model\Services\FormManager"]=> string(39) "Core\Factory\Manager\FormManagerFactory" ["Core\Model\Dao\FormDao"]=> string(31) "Core\Factory\Dao\FormDaoFactory" ["CoreFormGateway"]=> string(39) "Core\Factory\Gateway\FormGatewayFactory" ["Core\Model\Services\FormFieldsetManager"]=> string(47) "Core\Factory\Manager\FormFieldsetManagerFactory" ["Core\Model\Dao\FormFieldsetDao"]=> string(39) "Core\Factory\Dao\FormFieldsetDaoFactory" ["CoreFormFieldsetGateway"]=> string(47) "Core\Factory\Gateway\FormFieldsetGatewayFactory" ["Core\Model\Services\FormFieldManager"]=> string(44) "Core\Factory\Manager\FormFieldManagerFactory" ["Core\Model\Dao\FormFieldDao"]=> string(36) "Core\Factory\Dao\FormFieldDaoFactory" ["CoreFormFieldGateway"]=> string(44) "Core\Factory\Gateway\FormFieldGatewayFactory" ["Core\Model\Services\LanguageManager"]=> string(43) "Core\Factory\Manager\LanguageManagerFactory" ["Core\Model\Dao\LanguageDao"]=> string(35) "Core\Factory\Dao\LanguageDaoFactory" ["CoreLanguageGateway"]=> string(43) "Core\Factory\Gateway\LanguageGatewayFactory" ["Core\Model\Services\LibraryManager"]=> string(42) "Core\Factory\Manager\LibraryManagerFactory" ["Core\Model\Dao\LibraryDao"]=> string(34) "Core\Factory\Dao\LibraryDaoFactory" ["CoreLibraryGateway"]=> string(42) "Core\Factory\Gateway\LibraryGatewayFactory" ["Core\Model\Services\LibraryTypeManager"]=> string(46) "Core\Factory\Manager\LibraryTypeManagerFactory" ["Core\Model\Dao\LibraryTypeDao"]=> string(38) "Core\Factory\Dao\LibraryTypeDaoFactory" ["CoreLibraryTypeGateway"]=> string(46) "Core\Factory\Gateway\LibraryTypeGatewayFactory" ["Core\Model\Services\LibraryItemManager"]=> string(46) "Core\Factory\Manager\LibraryItemManagerFactory" ["Core\Model\Dao\LibraryItemDao"]=> string(38) "Core\Factory\Dao\LibraryItemDaoFactory" ["CoreLibraryItemGateway"]=> string(46) "Core\Factory\Gateway\LibraryItemGatewayFactory" ["Core\Model\Services\LibraryItemTypeManager"]=> string(50) "Core\Factory\Manager\LibraryItemTypeManagerFactory" ["Core\Model\Dao\LibraryItemTypeDao"]=> string(42) "Core\Factory\Dao\LibraryItemTypeDaoFactory" ["CoreLibraryItemTypeGateway"]=> string(50) "Core\Factory\Gateway\LibraryItemTypeGatewayFactory" ["Core\Model\Services\MessageManager"]=> string(42) "Core\Factory\Manager\MessageManagerFactory" ["Core\Model\Dao\MessageDao"]=> string(34) "Core\Factory\Dao\MessageDaoFactory" ["CoreMessageGateway"]=> string(42) "Core\Factory\Gateway\MessageGatewayFactory" ["Core\Model\Services\ModuleManager"]=> string(41) "Core\Factory\Manager\ModuleManagerFactory" ["Core\Model\Dao\ModuleDao"]=> string(33) "Core\Factory\Dao\ModuleDaoFactory" ["CoreModuleGateway"]=> string(41) "Core\Factory\Gateway\ModuleGatewayFactory" ["Core\Model\Services\ModuleParameterManager"]=> string(50) "Core\Factory\Manager\ModuleParameterManagerFactory" ["Core\Model\Dao\ModuleParameterDao"]=> string(42) "Core\Factory\Dao\ModuleParameterDaoFactory" ["CoreModuleParameterGateway"]=> string(50) "Core\Factory\Gateway\ModuleParameterGatewayFactory" ["Core\Model\Services\PageManager"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDao"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["CorePageGateway"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\PersonManager"]=> string(41) "Core\Factory\Manager\PersonManagerFactory" ["Core\Model\Dao\PersonDao"]=> string(33) "Core\Factory\Dao\PersonDaoFactory" ["CorePersonGateway"]=> string(41) "Core\Factory\Gateway\PersonGatewayFactory" ["Core\Model\Services\PersonRelationManager"]=> string(49) "Core\Factory\Manager\PersonRelationManagerFactory" ["Core\Model\Dao\PersonRelationDao"]=> string(41) "Core\Factory\Dao\PersonRelationDaoFactory" ["CorePersonRelationGateway"]=> string(49) "Core\Factory\Gateway\PersonRelationGatewayFactory" ["Core\Model\Services\PhoneManager"]=> string(40) "Core\Factory\Manager\PhoneManagerFactory" ["Core\Model\Dao\PhoneDao"]=> string(32) "Core\Factory\Dao\PhoneDaoFactory" ["CorePhoneGateway"]=> string(40) "Core\Factory\Gateway\PhoneGatewayFactory" ["Core\Model\Services\PhoneTypeManager"]=> string(44) "Core\Factory\Manager\PhoneTypeManagerFactory" ["Core\Model\Dao\PhoneTypeDao"]=> string(36) "Core\Factory\Dao\PhoneTypeDaoFactory" ["CorePhoneTypeGateway"]=> string(44) "Core\Factory\Gateway\PhoneTypeGatewayFactory" ["Core\Model\Services\RightManager"]=> string(40) "Core\Factory\Manager\RightManagerFactory" ["Core\Model\Dao\RightDao"]=> string(32) "Core\Factory\Dao\RightDaoFactory" ["CoreRightGateway"]=> string(40) "Core\Factory\Gateway\RightGatewayFactory" ["Core\Model\Services\RoleManager"]=> string(39) "Core\Factory\Manager\RoleManagerFactory" ["Core\Model\Dao\RoleDao"]=> string(31) "Core\Factory\Dao\RoleDaoFactory" ["CoreRoleGateway"]=> string(39) "Core\Factory\Gateway\RoleGatewayFactory" ["Core\Model\Services\RoleTypeManager"]=> string(43) "Core\Factory\Manager\RoleTypeManagerFactory" ["Core\Model\Dao\RoleTypeDao"]=> string(35) "Core\Factory\Dao\RoleTypeDaoFactory" ["CoreRoleTypeGateway"]=> string(43) "Core\Factory\Gateway\RoleTypeGatewayFactory" ["Core\Model\Services\RouteManager"]=> string(40) "Core\Factory\Manager\RouteManagerFactory" ["Core\Model\Dao\RouteDao"]=> string(32) "Core\Factory\Dao\RouteDaoFactory" ["CoreRouteGateway"]=> string(40) "Core\Factory\Gateway\RouteGatewayFactory" ["Core\Model\Services\ShortUrlManager"]=> string(43) "Core\Factory\Manager\ShortUrlManagerFactory" ["Core\Model\Dao\ShortUrlDao"]=> string(35) "Core\Factory\Dao\ShortUrlDaoFactory" ["CoreShortUrlGateway"]=> string(43) "Core\Factory\Gateway\ShortUrlGatewayFactory" ["Core\Model\Services\SiteManager"]=> string(39) "Core\Factory\Manager\SiteManagerFactory" ["Core\Model\Dao\SiteDao"]=> string(31) "Core\Factory\Dao\SiteDaoFactory" ["CoreSiteGateway"]=> string(39) "Core\Factory\Gateway\SiteGatewayFactory" ["Core\Model\Services\SiteDomainManager"]=> string(45) "Core\Factory\Manager\SiteDomainManagerFactory" ["Core\Model\Dao\SiteDomainDao"]=> string(37) "Core\Factory\Dao\SiteDomainDaoFactory" ["CoreSiteDomainGateway"]=> string(45) "Core\Factory\Gateway\SiteDomainGatewayFactory" ["Core\Model\Services\StateManager"]=> string(40) "Core\Factory\Manager\StateManagerFactory" ["Core\Model\Dao\StateDao"]=> string(32) "Core\Factory\Dao\StateDaoFactory" ["CoreStateGateway"]=> string(40) "Core\Factory\Gateway\StateGatewayFactory" ["Core\Model\Services\TemplateManager"]=> string(43) "Core\Factory\Manager\TemplateManagerFactory" ["Core\Model\Dao\TemplateDao"]=> string(35) "Core\Factory\Dao\TemplateDaoFactory" ["CoreTemplateGateway"]=> string(43) "Core\Factory\Gateway\TemplateGatewayFactory" ["Core\Model\Services\TemplateGroupManager"]=> string(48) "Core\Factory\Manager\TemplateGroupManagerFactory" ["Core\Model\Dao\TemplateGroupDao"]=> string(40) "Core\Factory\Dao\TemplateGroupDaoFactory" ["CoreTemplateGroupGateway"]=> string(48) "Core\Factory\Gateway\TemplateGroupGatewayFactory" ["Core\Model\Services\UserManager"]=> string(39) "Core\Factory\Manager\UserManagerFactory" ["Core\Model\Dao\UserDao"]=> string(31) "Core\Factory\Dao\UserDaoFactory" ["CoreUserGateway"]=> string(39) "Core\Factory\Gateway\UserGatewayFactory" ["Core\Model\Services\UserRoleManager"]=> string(43) "Core\Factory\Manager\UserRoleManagerFactory" ["Core\Model\Dao\UserRoleDao"]=> string(35) "Core\Factory\Dao\UserRoleDaoFactory" ["CoreUserRoleGateway"]=> string(43) "Core\Factory\Gateway\UserRoleGatewayFactory" ["Core\Model\Services\UserFavoritObjectManager"]=> string(52) "Core\Factory\Manager\UserFavoritObjectManagerFactory" ["Core\Model\Dao\UserFavoritObjectDao"]=> string(44) "Core\Factory\Dao\UserFavoritObjectDaoFactory" ["CoreUserFavoritObjectGateway"]=> string(52) "Core\Factory\Gateway\UserFavoritObjectGatewayFactory" ["Core\Model\Services\UserSessionManager"]=> string(46) "Core\Factory\Manager\UserSessionManagerFactory" ["Core\Model\Dao\UserSessionDao"]=> string(38) "Core\Factory\Dao\UserSessionDaoFactory" ["CoreUserSessionGateway"]=> string(46) "Core\Factory\Gateway\UserSessionGatewayFactory" ["Core\Model\Services\WebsiteManager"]=> string(42) "Core\Factory\Manager\WebsiteManagerFactory" ["Core\Model\Dao\WebsiteDao"]=> string(34) "Core\Factory\Dao\WebsiteDaoFactory" ["CoreWebsiteGateway"]=> string(42) "Core\Factory\Gateway\WebsiteGatewayFactory" ["Core\Model\Services\WebsiteTypeManager"]=> string(46) "Core\Factory\Manager\WebsiteTypeManagerFactory" ["Core\Model\Dao\WebsiteTypeDao"]=> string(38) "Core\Factory\Dao\WebsiteTypeDaoFactory" ["CoreWebsiteTypeGateway"]=> string(46) "Core\Factory\Gateway\WebsiteTypeGatewayFactory" ["CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyManager"]=> string(45) "Company\Factory\Manager\CompanyManagerFactory" ["Company\Model\Dao\CompanyDao"]=> string(37) "Company\Factory\Dao\CompanyDaoFactory" ["CompanyCompanyGateway"]=> string(45) "Company\Factory\Gateway\CompanyGatewayFactory" ["Company\Model\Services\DomainManager"]=> string(44) "Company\Factory\Manager\DomainManagerFactory" ["Company\Model\Dao\DomainDao"]=> string(36) "Company\Factory\Dao\DomainDaoFactory" ["CompanyDomainGateway"]=> string(44) "Company\Factory\Gateway\DomainGatewayFactory" ["Company\Model\Services\CompanyFunctionManager"]=> string(53) "Company\Factory\Manager\CompanyFunctionManagerFactory" ["Company\Model\Dao\CompanyFunctionDao"]=> string(45) "Company\Factory\Dao\CompanyFunctionDaoFactory" ["CompanyCompanyFunctionGateway"]=> string(53) "Company\Factory\Gateway\CompanyFunctionGatewayFactory" ["Company\Model\Services\EmployeeManager"]=> string(46) "Company\Factory\Manager\EmployeeManagerFactory" ["Company\Model\Dao\EmployeeDao"]=> string(38) "Company\Factory\Dao\EmployeeDaoFactory" ["CompanyEmployeeGateway"]=> string(46) "Company\Factory\Gateway\EmployeeGatewayFactory" ["Company\Model\Services\ContractManager"]=> string(46) "Company\Factory\Manager\ContractManagerFactory" ["Company\Model\Dao\ContractDao"]=> string(38) "Company\Factory\Dao\ContractDaoFactory" ["CompanyContractGateway"]=> string(46) "Company\Factory\Gateway\ContractGatewayFactory" ["Company\Model\Services\ContractTypeManager"]=> string(50) "Company\Factory\Manager\ContractTypeManagerFactory" ["Company\Model\Dao\ContractTypeDao"]=> string(42) "Company\Factory\Dao\ContractTypeDaoFactory" ["CompanyContractTypeGateway"]=> string(50) "Company\Factory\Gateway\ContractTypeGatewayFactory" ["StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["StructuredData\Model\Services\StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactManager"]=> string(45) "Contact\Factory\Manager\ContactManagerFactory" ["Contact\Model\Dao\ContactDao"]=> string(37) "Contact\Factory\Dao\ContactDaoFactory" ["ContactContactGateway"]=> string(45) "Contact\Factory\Gateway\ContactGatewayFactory" ["Contact\Model\Services\ContactAnswerManager"]=> string(51) "Contact\Factory\Manager\ContactAnswerManagerFactory" ["Contact\Model\Dao\ContactAnswerDao"]=> string(43) "Contact\Factory\Dao\ContactAnswerDaoFactory" ["ContactContactAnswerGateway"]=> string(51) "Contact\Factory\Gateway\ContactAnswerGatewayFactory" ["Contact\Model\Services\ContactCommentManager"]=> string(52) "Contact\Factory\Manager\ContactCommentManagerFactory" ["Contact\Model\Dao\ContactCommentDao"]=> string(44) "Contact\Factory\Dao\ContactCommentDaoFactory" ["ContactContactCommentGateway"]=> string(52) "Contact\Factory\Gateway\ContactCommentGatewayFactory" ["Contact\Model\Services\ContactStatusManager"]=> string(51) "Contact\Factory\Manager\ContactStatusManagerFactory" ["Contact\Model\Dao\ContactStatusDao"]=> string(43) "Contact\Factory\Dao\ContactStatusDaoFactory" ["ContactContactStatusGateway"]=> string(51) "Contact\Factory\Gateway\ContactStatusGatewayFactory" ["GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleryManager"]=> string(47) "Galleries\Factory\Manager\GalleryManagerFactory" ["Galleries\Model\Dao\GalleryDao"]=> string(39) "Galleries\Factory\Dao\GalleryDaoFactory" ["GalleriesGalleryGateway"]=> string(47) "Galleries\Factory\Gateway\GalleryGatewayFactory" ["Galleries\Model\Services\ItemManager"]=> string(44) "Galleries\Factory\Manager\ItemManagerFactory" ["Galleries\Model\Dao\ItemDao"]=> string(36) "Galleries\Factory\Dao\ItemDaoFactory" ["GalleriesItemGateway"]=> string(44) "Galleries\Factory\Gateway\ItemGatewayFactory" ["Galleries\Model\Services\ItemTypeManager"]=> string(48) "Galleries\Factory\Manager\ItemTypeManagerFactory" ["Galleries\Model\Dao\ItemTypeDao"]=> string(40) "Galleries\Factory\Dao\ItemTypeDaoFactory" ["GalleriesItemTypeGateway"]=> string(48) "Galleries\Factory\Gateway\ItemTypeGatewayFactory" ["Galleries\Model\Services\ItemCommentManager"]=> string(51) "Galleries\Factory\Manager\ItemCommentManagerFactory" ["Galleries\Model\Dao\ItemCommentDao"]=> string(43) "Galleries\Factory\Dao\ItemCommentDaoFactory" ["GalleriesItemCommentGateway"]=> string(51) "Galleries\Factory\Gateway\ItemCommentGatewayFactory" ["LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogManager"]=> string(38) "Logs\Factory\Manager\LogManagerFactory" ["Logs\Model\Dao\LogDao"]=> string(30) "Logs\Factory\Dao\LogDaoFactory" ["LogsLogGateway"]=> string(38) "Logs\Factory\Gateway\LogGatewayFactory" ["MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuManager"]=> string(39) "Menu\Factory\Manager\MenuManagerFactory" ["Menu\Model\Dao\MenuDao"]=> string(31) "Menu\Factory\Dao\MenuDaoFactory" ["MenuMenuGateway"]=> string(39) "Menu\Factory\Gateway\MenuGatewayFactory" ["Menu\Model\Services\MenuItemManager"]=> string(43) "Menu\Factory\Manager\MenuItemManagerFactory" ["Menu\Model\Dao\MenuItemDao"]=> string(35) "Menu\Factory\Dao\MenuItemDaoFactory" ["MenuMenuItemGateway"]=> string(43) "Menu\Factory\Gateway\MenuItemGatewayFactory" ["WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetManager"]=> string(43) "Widget\Factory\Manager\WidgetManagerFactory" ["Widget\Model\Dao\WidgetDao"]=> string(35) "Widget\Factory\Dao\WidgetDaoFactory" ["WidgetWidgetGateway"]=> string(43) "Widget\Factory\Gateway\WidgetGatewayFactory" ["Widget\Model\Services\WidgetPositionManager"]=> string(51) "Widget\Factory\Manager\WidgetPositionManagerFactory" ["Widget\Model\Dao\WidgetPositionDao"]=> string(43) "Widget\Factory\Dao\WidgetPositionDaoFactory" ["WidgetWidgetPositionGateway"]=> string(51) "Widget\Factory\Gateway\WidgetPositionGatewayFactory" ["ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductManager"]=> string(46) "Products\Factory\Manager\ProductManagerFactory" ["Products\Model\Dao\ProductDao"]=> string(38) "Products\Factory\Dao\ProductDaoFactory" ["ProductsProductGateway"]=> string(46) "Products\Factory\Gateway\ProductGatewayFactory" ["Products\Model\Services\CategoryManager"]=> string(47) "Products\Factory\Manager\CategoryManagerFactory" ["Products\Model\Dao\CategoryDao"]=> string(39) "Products\Factory\Dao\CategoryDaoFactory" ["ProductsCategoryGateway"]=> string(47) "Products\Factory\Gateway\CategoryGatewayFactory" ["Products\Model\Services\ProductTypeManager"]=> string(50) "Products\Factory\Manager\ProductTypeManagerFactory" ["Products\Model\Dao\ProductTypeDao"]=> string(42) "Products\Factory\Dao\ProductTypeDaoFactory" ["ProductsProductTypeGateway"]=> string(50) "Products\Factory\Gateway\ProductTypeGatewayFactory" ["Products\Model\Services\BrandManager"]=> string(44) "Products\Factory\Manager\BrandManagerFactory" ["Products\Model\Dao\BrandDao"]=> string(36) "Products\Factory\Dao\BrandDaoFactory" ["ProductsBrandGateway"]=> string(44) "Products\Factory\Gateway\BrandGatewayFactory" ["Products\Model\Services\CriteriaManager"]=> string(47) "Products\Factory\Manager\CriteriaManagerFactory" ["Products\Model\Dao\CriteriaDao"]=> string(39) "Products\Factory\Dao\CriteriaDaoFactory" ["ProductsCriteriaGateway"]=> string(47) "Products\Factory\Gateway\CriteriaGatewayFactory" ["ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopManager"]=> string(39) "Shop\Factory\Manager\ShopManagerFactory" ["Shop\Model\Dao\ShopDao"]=> string(31) "Shop\Factory\Dao\ShopDaoFactory" ["ShopShopGateway"]=> string(39) "Shop\Factory\Gateway\ShopGatewayFactory" ["Shop\Model\Services\ShopProductManager"]=> string(63) "Caveschateauauvernier\Factory\Manager\ShopProductManagerFactory" ["Shop\Model\Dao\ShopProductDao"]=> string(38) "Shop\Factory\Dao\ShopProductDaoFactory" ["ShopShopProductGateway"]=> string(46) "Shop\Factory\Gateway\ShopProductGatewayFactory" ["Shop\Model\Services\CategoryManager"]=> string(43) "Shop\Factory\Manager\CategoryManagerFactory" ["Shop\Model\Dao\CategoryDao"]=> string(35) "Shop\Factory\Dao\CategoryDaoFactory" ["ShopCategoryGateway"]=> string(43) "Shop\Factory\Gateway\CategoryGatewayFactory" ["Shop\Model\Services\OrderManager"]=> string(40) "Shop\Factory\Manager\OrderManagerFactory" ["Shop\Model\Dao\OrderDao"]=> string(32) "Shop\Factory\Dao\OrderDaoFactory" ["ShopOrderGateway"]=> string(40) "Shop\Factory\Gateway\OrderGatewayFactory" ["Shop\Model\Services\OrderItemManager"]=> string(44) "Shop\Factory\Manager\OrderItemManagerFactory" ["Shop\Model\Dao\OrderItemDao"]=> string(36) "Shop\Factory\Dao\OrderItemDaoFactory" ["ShopOrderItemGateway"]=> string(44) "Shop\Factory\Gateway\OrderItemGatewayFactory" ["Shop\Model\Services\TaxManager"]=> string(38) "Shop\Factory\Manager\TaxManagerFactory" ["Shop\Model\Dao\TaxDao"]=> string(30) "Shop\Factory\Dao\TaxDaoFactory" ["ShopTaxGateway"]=> string(38) "Shop\Factory\Gateway\TaxGatewayFactory" ["Shop\Model\Services\TaxGroupManager"]=> string(43) "Shop\Factory\Manager\TaxGroupManagerFactory" ["Shop\Model\Dao\TaxGroupDao"]=> string(35) "Shop\Factory\Dao\TaxGroupDaoFactory" ["ShopTaxGroupGateway"]=> string(43) "Shop\Factory\Gateway\TaxGroupGatewayFactory" ["Shop\Model\Services\TaxRuleManager"]=> string(42) "Shop\Factory\Manager\TaxRuleManagerFactory" ["Shop\Model\Dao\TaxRuleDao"]=> string(34) "Shop\Factory\Dao\TaxRuleDaoFactory" ["ShopTaxRuleGateway"]=> string(42) "Shop\Factory\Gateway\TaxRuleGatewayFactory" ["Shop\Model\Services\PriceTableManager"]=> string(45) "Shop\Factory\Manager\PriceTableManagerFactory" ["Shop\Model\Dao\PriceTableDao"]=> string(37) "Shop\Factory\Dao\PriceTableDaoFactory" ["ShopPriceTableGateway"]=> string(45) "Shop\Factory\Gateway\PriceTableGatewayFactory" ["Shop\Model\Services\PriceTableConditionnementManager"]=> string(60) "Shop\Factory\Manager\PriceTableConditionnementManagerFactory" ["Shop\Model\Dao\PriceTableConditionnementDao"]=> string(52) "Shop\Factory\Dao\PriceTableConditionnementDaoFactory" ["ShopPriceTableConditionnementGateway"]=> string(60) "Shop\Factory\Gateway\PriceTableConditionnementGatewayFactory" ["Shop\Model\Services\WishListManager"]=> string(43) "Shop\Factory\Manager\WishListManagerFactory" ["Shop\Model\Dao\WishListDao"]=> string(35) "Shop\Factory\Dao\WishListDaoFactory" ["ShopWishListGateway"]=> string(43) "Shop\Factory\Gateway\WishListGatewayFactory" ["Shop\Model\Services\PromotionManager"]=> string(44) "Shop\Factory\Manager\PromotionManagerFactory" ["Shop\Model\Dao\PromotionDao"]=> string(36) "Shop\Factory\Dao\PromotionDaoFactory" ["ShopPromotionGateway"]=> string(44) "Shop\Factory\Gateway\PromotionGatewayFactory" ["Shop\Model\Services\PromotionItemManager"]=> string(48) "Shop\Factory\Manager\PromotionItemManagerFactory" ["Shop\Model\Dao\PromotionItemDao"]=> string(40) "Shop\Factory\Dao\PromotionItemDaoFactory" ["ShopPromotionItemGateway"]=> string(48) "Shop\Factory\Gateway\PromotionItemGatewayFactory" ["Shop\Model\Services\CartManager"]=> string(39) "Shop\Factory\Manager\CartManagerFactory" ["Shop\Model\Dao\CartDao"]=> string(31) "Shop\Factory\Dao\CartDaoFactory" ["ShopCartGateway"]=> string(39) "Shop\Factory\Gateway\CartGatewayFactory" ["Shop\Model\Services\CartItemManager"]=> string(43) "Shop\Factory\Manager\CartItemManagerFactory" ["Shop\Model\Dao\CartItemDao"]=> string(35) "Shop\Factory\Dao\CartItemDaoFactory" ["ShopCartItemGateway"]=> string(43) "Shop\Factory\Gateway\CartItemGatewayFactory" ["Shop\Model\Services\CartConstraintManager"]=> string(49) "Shop\Factory\Manager\CartConstraintManagerFactory" ["Shop\Model\Dao\CartConstraintDao"]=> string(41) "Shop\Factory\Dao\CartConstraintDaoFactory" ["ShopCartConstraintGateway"]=> string(49) "Shop\Factory\Gateway\CartConstraintGatewayFactory" ["Shop\Model\Services\CartRuleManager"]=> string(43) "Shop\Factory\Manager\CartRuleManagerFactory" ["Shop\Model\Dao\CartRuleDao"]=> string(35) "Shop\Factory\Dao\CartRuleDaoFactory" ["ShopCartRuleGateway"]=> string(43) "Shop\Factory\Gateway\CartRuleGatewayFactory" ["Shop\Model\Services\CartRuleRestrictionManager"]=> string(54) "Shop\Factory\Manager\CartRuleRestrictionManagerFactory" ["Shop\Model\Dao\CartRuleRestrictionDao"]=> string(46) "Shop\Factory\Dao\CartRuleRestrictionDaoFactory" ["ShopCartRuleRestrictionGateway"]=> string(54) "Shop\Factory\Gateway\CartRuleRestrictionGatewayFactory" ["Shop\Model\Services\OrderCartRuleManager"]=> string(48) "Shop\Factory\Manager\OrderCartRuleManagerFactory" ["Shop\Model\Dao\OrderCartRuleDao"]=> string(40) "Shop\Factory\Dao\OrderCartRuleDaoFactory" ["ShopOrderCartRuleGateway"]=> string(48) "Shop\Factory\Gateway\OrderCartRuleGatewayFactory" ["Shop\Model\Services\OrderCartRuleRestrictionManager"]=> string(59) "Shop\Factory\Manager\OrderCartRuleRestrictionManagerFactory" ["Shop\Model\Dao\OrderCartRuleRestrictionDao"]=> string(51) "Shop\Factory\Dao\OrderCartRuleRestrictionDaoFactory" ["ShopOrderCartRuleRestrictionGateway"]=> string(59) "Shop\Factory\Gateway\OrderCartRuleRestrictionGatewayFactory" ["PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentManager"]=> string(46) "Payments\Factory\Manager\PaymentManagerFactory" ["Payments\Model\Dao\PaymentDao"]=> string(38) "Payments\Factory\Dao\PaymentDaoFactory" ["PaymentsPaymentGateway"]=> string(46) "Payments\Factory\Gateway\PaymentGatewayFactory" ["Payments\Model\Services\PaymentTypeManager"]=> string(50) "Payments\Factory\Manager\PaymentTypeManagerFactory" ["Payments\Model\Dao\PaymentTypeDao"]=> string(42) "Payments\Factory\Dao\PaymentTypeDaoFactory" ["PaymentsPaymentTypeGateway"]=> string(50) "Payments\Factory\Gateway\PaymentTypeGatewayFactory" ["TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialManager"]=> string(54) "Testimonials\Factory\Manager\TestimonialManagerFactory" ["Testimonials\Model\Dao\TestimonialDao"]=> string(46) "Testimonials\Factory\Dao\TestimonialDaoFactory" ["TestimonialsTestimonialGateway"]=> string(54) "Testimonials\Factory\Gateway\TestimonialGatewayFactory" ["ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopAnalytics\Model\Services\ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["ShopStructuredData\Model\Services\ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\PaymentManager"]=> string(46) "Checkout\Factory\Manager\PaymentManagerFactory" ["Checkout\Model\Services\API\WebHookUrlManager"]=> string(53) "Checkout\Factory\Manager\API\WebHookUrlManagerFactory" ["RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["Recaptcha\Model\Services\RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Caveschateauauvernier\Model\Services\CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Sentry\ClientInterface"]=> string(36) "SentryIO\Service\ClientConfigFactory" ["Sentry\State\HubInterface"]=> string(27) "SentryIO\Service\HubFactory" ["SentryIO\Listener\ErrorHandlerListener"]=> string(45) "SentryIO\Listener\ErrorHandlerListenerFactory" ["Laminas\Db\Adapter\Adapter"]=> string(40) "Laminas\Db\Adapter\AdapterServiceFactory" } ["delegators"]=> array(4) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> array(2) { [0]=> string(77) "Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory" [1]=> string(76) "Laminas\Cache\Storage\Adapter\BlackHole\AdapterPluginManagerDelegatorFactory" } ["HttpRouter"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["Laminas\Router\Http\TreeRouteStack"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["ViewHelperManager"]=> array(1) { [0]=> string(57) "Laminas\Navigation\View\ViewHelperManagerDelegatorFactory" } } ["aliases"]=> array(244) { ["Zend\Di\InjectorInterface"]=> string(28) "Laminas\Di\InjectorInterface" ["Zend\Di\ConfigInterface"]=> string(26) "Laminas\Di\ConfigInterface" ["Zend\Di\CodeGenerator\InjectorGenerator"]=> string(42) "Laminas\Di\CodeGenerator\InjectorGenerator" ["MvcTranslator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["Zend\Mvc\I18n\Translator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["InputFilterManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["Zend\InputFilter\InputFilterPluginManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["HttpRouter"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["router"]=> string(34) "Laminas\Router\RouteStackInterface" ["Router"]=> string(34) "Laminas\Router\RouteStackInterface" ["RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\Http\TreeRouteStack"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["Zend\Router\RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\RouteStackInterface"]=> string(34) "Laminas\Router\RouteStackInterface" ["Laminas\Form\Annotation\AnnotationBuilder"]=> string(21) "FormAnnotationBuilder" ["Laminas\Form\Annotation\AttributeBuilder"]=> string(20) "FormAttributeBuilder" ["Laminas\Form\FormElementManager"]=> string(18) "FormElementManager" ["ValidatorManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Validator\ValidatorPluginManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Mail\Protocol\SmtpPluginManager"]=> string(39) "Laminas\Mail\Protocol\SmtpPluginManager" ["TranslatorPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["Zend\I18n\Translator\TranslatorInterface"]=> string(43) "Laminas\I18n\Translator\TranslatorInterface" ["Zend\I18n\Translator\LoaderPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Zend\Navigation\Navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Core\Interfaces\AddressManagerInterface"]=> string(34) "Core\Model\Services\AddressManager" ["Core\Interfaces\AddressDaoInterface"]=> string(25) "Core\Model\Dao\AddressDao" ["Core\Interfaces\AddressTypeManagerInterface"]=> string(38) "Core\Model\Services\AddressTypeManager" ["Core\Interfaces\AddressTypeDaoInterface"]=> string(29) "Core\Model\Dao\AddressTypeDao" ["Core\Interfaces\AjaxRightManagerInterface"]=> string(36) "Core\Model\Services\AjaxRightManager" ["Core\Interfaces\AjaxRightDaoInterface"]=> string(27) "Core\Model\Dao\AjaxRightDao" ["Core\Interfaces\BankManagerInterface"]=> string(31) "Core\Model\Services\BankManager" ["Core\Interfaces\BankDaoInterface"]=> string(22) "Core\Model\Dao\BankDao" ["Core\Interfaces\BankAccountManagerInterface"]=> string(38) "Core\Model\Services\BankAccountManager" ["Core\Interfaces\BankAccountDaoInterface"]=> string(29) "Core\Model\Dao\BankAccountDao" ["Core\Interfaces\BankAddressManagerInterface"]=> string(38) "Core\Model\Services\BankAddressManager" ["Core\Interfaces\BankAddressDaoInterface"]=> string(29) "Core\Model\Dao\BankAddressDao" ["Core\Interfaces\CertificateManagerInterface"]=> string(38) "Core\Model\Services\CertificateManager" ["Core\Interfaces\CertificateDaoInterface"]=> string(29) "Core\Model\Dao\CertificateDao" ["Core\Interfaces\ClosedDayManagerInterface"]=> string(36) "Core\Model\Services\ClosedDayManager" ["Core\Interfaces\ClosedDayDaoInterface"]=> string(27) "Core\Model\Dao\ClosedDayDao" ["Core\Interfaces\ClosedDayTypeManagerInterface"]=> string(40) "Core\Model\Services\ClosedDayTypeManager" ["Core\Interfaces\ClosedDayTypeDaoInterface"]=> string(31) "Core\Model\Dao\ClosedDayTypeDao" ["Core\Interfaces\CmsListManagerInterface"]=> string(34) "Core\Model\Services\CmsListManager" ["Core\Interfaces\CmsListDaoInterface"]=> string(25) "Core\Model\Dao\CmsListDao" ["Core\Interfaces\CmsListItemManagerInterface"]=> string(38) "Core\Model\Services\CmsListItemManager" ["Core\Interfaces\CmsListItemDaoInterface"]=> string(29) "Core\Model\Dao\CmsListItemDao" ["Core\Interfaces\ContentManagerInterface"]=> string(34) "Core\Model\Services\ContentManager" ["Core\Interfaces\ContentDaoInterface"]=> string(25) "Core\Model\Dao\ContentDao" ["Core\Interfaces\CmsObjectManagerInterface"]=> string(36) "Core\Model\Services\CmsObjectManager" ["Core\Interfaces\CmsObjectDaoInterface"]=> string(27) "Core\Model\Dao\CmsObjectDao" ["Core\Interfaces\CmsObjectTypeManagerInterface"]=> string(40) "Core\Model\Services\CmsObjectTypeManager" ["Core\Interfaces\CmsObjectTypeDaoInterface"]=> string(31) "Core\Model\Dao\CmsObjectTypeDao" ["Core\Interfaces\CmsObjectPropertyManagerInterface"]=> string(44) "Core\Model\Services\CmsObjectPropertyManager" ["Core\Interfaces\CmsObjectPropertyDaoInterface"]=> string(35) "Core\Model\Dao\CmsObjectPropertyDao" ["Core\Interfaces\CmsObjectPropertyTypeManagerInterface"]=> string(48) "Core\Model\Services\CmsObjectPropertyTypeManager" ["Core\Interfaces\CmsObjectPropertyTypeDaoInterface"]=> string(39) "Core\Model\Dao\CmsObjectPropertyTypeDao" ["Core\Interfaces\CmsUserManagerInterface"]=> string(34) "Core\Model\Services\CmsUserManager" ["Core\Interfaces\CmsUserDaoInterface"]=> string(25) "Core\Model\Dao\CmsUserDao" ["Core\Interfaces\ControllerActionManagerInterface"]=> string(43) "Core\Model\Services\ControllerActionManager" ["Core\Interfaces\ControllerActionDaoInterface"]=> string(34) "Core\Model\Dao\ControllerActionDao" ["Core\Interfaces\ControllerActionTemplateManagerInterface"]=> string(51) "Core\Model\Services\ControllerActionTemplateManager" ["Core\Interfaces\ControllerActionTemplateDaoInterface"]=> string(42) "Core\Model\Dao\ControllerActionTemplateDao" ["Core\Interfaces\CurrencyManagerInterface"]=> string(35) "Core\Model\Services\CurrencyManager" ["Core\Interfaces\CurrencyDaoInterface"]=> string(26) "Core\Model\Dao\CurrencyDao" ["Core\Interfaces\CityManagerInterface"]=> string(31) "Core\Model\Services\CityManager" ["Core\Interfaces\CityDaoInterface"]=> string(22) "Core\Model\Dao\CityDao" ["Core\Interfaces\ContinentManagerInterface"]=> string(36) "Core\Model\Services\ContinentManager" ["Core\Interfaces\ContinentDaoInterface"]=> string(27) "Core\Model\Dao\ContinentDao" ["Core\Interfaces\CountryManagerInterface"]=> string(34) "Core\Model\Services\CountryManager" ["Core\Interfaces\CountryDaoInterface"]=> string(25) "Core\Model\Dao\CountryDao" ["Core\Interfaces\DebugIpManagerInterface"]=> string(34) "Core\Model\Services\DebugIpManager" ["Core\Interfaces\DebugIpDaoInterface"]=> string(25) "Core\Model\Dao\DebugIpDao" ["Core\Interfaces\DeliveryTypeManagerInterface"]=> string(39) "Core\Model\Services\DeliveryTypeManager" ["Core\Interfaces\DeliveryTypeDaoInterface"]=> string(30) "Core\Model\Dao\DeliveryTypeDao" ["Core\Interfaces\EmailManagerInterface"]=> string(32) "Core\Model\Services\EmailManager" ["Core\Interfaces\EmailDaoInterface"]=> string(23) "Core\Model\Dao\EmailDao" ["Core\Interfaces\EmailMessageManagerInterface"]=> string(39) "Core\Model\Services\EmailMessageManager" ["Core\Interfaces\EmailMessageDaoInterface"]=> string(30) "Core\Model\Dao\EmailMessageDao" ["Core\Interfaces\EmailTypeManagerInterface"]=> string(36) "Core\Model\Services\EmailTypeManager" ["Core\Interfaces\EmailTypeDaoInterface"]=> string(27) "Core\Model\Dao\EmailTypeDao" ["Core\Interfaces\EntityRightManagerInterface"]=> string(38) "Core\Model\Services\EntityRightManager" ["Core\Interfaces\EntityRightDaoInterface"]=> string(29) "Core\Model\Dao\EntityRightDao" ["Core\Interfaces\ExtranetUserManagerInterface"]=> string(39) "Core\Model\Services\ExtranetUserManager" ["Core\Interfaces\ExtranetUserDaoInterface"]=> string(30) "Core\Model\Dao\ExtranetUserDao" ["Core\Interfaces\FormManagerInterface"]=> string(31) "Core\Model\Services\FormManager" ["Core\Interfaces\FormDaoInterface"]=> string(22) "Core\Model\Dao\FormDao" ["Core\Interfaces\FormFieldsetManagerInterface"]=> string(39) "Core\Model\Services\FormFieldsetManager" ["Core\Interfaces\FormFieldsetDaoInterface"]=> string(30) "Core\Model\Dao\FormFieldsetDao" ["Core\Interfaces\FormFieldManagerInterface"]=> string(36) "Core\Model\Services\FormFieldManager" ["Core\Interfaces\FormFieldDaoInterface"]=> string(27) "Core\Model\Dao\FormFieldDao" ["Core\Interfaces\LanguageManagerInterface"]=> string(35) "Core\Model\Services\LanguageManager" ["Core\Interfaces\LanguageDaoInterface"]=> string(26) "Core\Model\Dao\LanguageDao" ["Core\Interfaces\LibraryManagerInterface"]=> string(34) "Core\Model\Services\LibraryManager" ["Core\Interfaces\LibraryDaoInterface"]=> string(25) "Core\Model\Dao\LibraryDao" ["Core\Interfaces\LibraryTypeManagerInterface"]=> string(38) "Core\Model\Services\LibraryTypeManager" ["Core\Interfaces\LibraryTypeDaoInterface"]=> string(29) "Core\Model\Dao\LibraryTypeDao" ["Core\Interfaces\LibraryItemManagerInterface"]=> string(38) "Core\Model\Services\LibraryItemManager" ["Core\Interfaces\LibraryItemDaoInterface"]=> string(29) "Core\Model\Dao\LibraryItemDao" ["Core\Interfaces\LibraryItemTypeManagerInterface"]=> string(42) "Core\Model\Services\LibraryItemTypeManager" ["Core\Interfaces\LibraryItemTypeDaoInterface"]=> string(33) "Core\Model\Dao\LibraryItemTypeDao" ["Core\Interfaces\MessageManagerInterface"]=> string(34) "Core\Model\Services\MessageManager" ["Core\Interfaces\MessageDaoInterface"]=> string(25) "Core\Model\Dao\MessageDao" ["Core\Interfaces\ModuleManagerInterface"]=> string(33) "Core\Model\Services\ModuleManager" ["Core\Interfaces\ModuleDaoInterface"]=> string(24) "Core\Model\Dao\ModuleDao" ["Core\Interfaces\ModuleParameterManagerInterface"]=> string(42) "Core\Model\Services\ModuleParameterManager" ["Core\Interfaces\ModuleParameterDaoInterface"]=> string(33) "Core\Model\Dao\ModuleParameterDao" ["Core\Interfaces\PageManagerInterface"]=> string(31) "Core\Model\Services\PageManager" ["Core\Interfaces\PageDaoInterface"]=> string(22) "Core\Model\Dao\PageDao" ["Core\Interfaces\PersonManagerInterface"]=> string(33) "Core\Model\Services\PersonManager" ["Core\Interfaces\PersonDaoInterface"]=> string(24) "Core\Model\Dao\PersonDao" ["Core\Interfaces\PersonRelationManagerInterface"]=> string(41) "Core\Model\Services\PersonRelationManager" ["Core\Interfaces\PersonRelationDaoInterface"]=> string(32) "Core\Model\Dao\PersonRelationDao" ["Core\Interfaces\PhoneManagerInterface"]=> string(32) "Core\Model\Services\PhoneManager" ["Core\Interfaces\PhoneDaoInterface"]=> string(23) "Core\Model\Dao\PhoneDao" ["Core\Interfaces\PhoneTypeManagerInterface"]=> string(36) "Core\Model\Services\PhoneTypeManager" ["Core\Interfaces\PhoneTypeDaoInterface"]=> string(27) "Core\Model\Dao\PhoneTypeDao" ["Core\Interfaces\RightManagerInterface"]=> string(32) "Core\Model\Services\RightManager" ["Core\Interfaces\RightDaoInterface"]=> string(23) "Core\Model\Dao\RightDao" ["Core\Interfaces\RoleManagerInterface"]=> string(31) "Core\Model\Services\RoleManager" ["Core\Interfaces\RoleDaoInterface"]=> string(22) "Core\Model\Dao\RoleDao" ["Core\Interfaces\RoleTypeManagerInterface"]=> string(35) "Core\Model\Services\RoleTypeManager" ["Core\Interfaces\RoleTypeDaoInterface"]=> string(26) "Core\Model\Dao\RoleTypeDao" ["Core\Interfaces\RouteManagerInterface"]=> string(32) "Core\Model\Services\RouteManager" ["Core\Interfaces\RouteDaoInterface"]=> string(23) "Core\Model\Dao\RouteDao" ["Core\Interfaces\ShortUrlManagerInterface"]=> string(35) "Core\Model\Services\ShortUrlManager" ["Core\Interfaces\ShortUrlDaoInterface"]=> string(26) "Core\Model\Dao\ShortUrlDao" ["Core\Interfaces\SiteManagerInterface"]=> string(31) "Core\Model\Services\SiteManager" ["Core\Interfaces\SiteDaoInterface"]=> string(22) "Core\Model\Dao\SiteDao" ["Core\Interfaces\SiteDomainManagerInterface"]=> string(37) "Core\Model\Services\SiteDomainManager" ["Core\Interfaces\SiteDomainDaoInterface"]=> string(28) "Core\Model\Dao\SiteDomainDao" ["Core\Interfaces\StateManagerInterface"]=> string(32) "Core\Model\Services\StateManager" ["Core\Interfaces\StateDaoInterface"]=> string(23) "Core\Model\Dao\StateDao" ["Core\Interfaces\TemplateManagerInterface"]=> string(35) "Core\Model\Services\TemplateManager" ["Core\Interfaces\TemplateDaoInterface"]=> string(26) "Core\Model\Dao\TemplateDao" ["Core\Interfaces\TemplateGroupManagerInterface"]=> string(40) "Core\Model\Services\TemplateGroupManager" ["Core\Interfaces\TemplateGroupDaoInterface"]=> string(31) "Core\Model\Dao\TemplateGroupDao" ["Core\Interfaces\UserManagerInterface"]=> string(31) "Core\Model\Services\UserManager" ["Core\Interfaces\UserDaoInterface"]=> string(22) "Core\Model\Dao\UserDao" ["Core\Interfaces\UserSessionManagerInterface"]=> string(38) "Core\Model\Services\UserSessionManager" ["Core\Interfaces\UserSessionDaoInterface"]=> string(29) "Core\Model\Dao\UserSessionDao" ["Core\Interfaces\UserRoleManagerInterface"]=> string(35) "Core\Model\Services\UserRoleManager" ["Core\Interfaces\UserRoleDaoInterface"]=> string(26) "Core\Model\Dao\UserRoleDao" ["Core\Interfaces\UserFavoritObjectManagerInterface"]=> string(44) "Core\Model\Services\UserFavoritObjectManager" ["Core\Interfaces\UserFavoritObjectDaoInterface"]=> string(35) "Core\Model\Dao\UserFavoritObjectDao" ["Core\Interfaces\WebsiteManagerInterface"]=> string(34) "Core\Model\Services\WebsiteManager" ["Core\Interfaces\WebsiteDaoInterface"]=> string(25) "Core\Model\Dao\WebsiteDao" ["Core\Interfaces\WebsiteTypeManagerInterface"]=> string(38) "Core\Model\Services\WebsiteTypeManager" ["Core\Interfaces\WebsiteTypeDaoInterface"]=> string(29) "Core\Model\Dao\WebsiteTypeDao" ["Company\Interfaces\CompanyManagerInterface"]=> string(37) "Company\Model\Services\CompanyManager" ["Company\Interfaces\CompanyDaoInterface"]=> string(28) "Company\Model\Dao\CompanyDao" ["Company\Interfaces\DomainManagerInterface"]=> string(36) "Company\Model\Services\DomainManager" ["Company\Interfaces\DomainDaoInterface"]=> string(27) "Company\Model\Dao\DomainDao" ["Company\Interfaces\CompanyFunctionManagerInterface"]=> string(45) "Company\Model\Services\CompanyFunctionManager" ["Company\Interfaces\CompanyFunctionDaoInterface"]=> string(36) "Company\Model\Dao\CompanyFunctionDao" ["Company\Interfaces\EmployeeManagerInterface"]=> string(38) "Company\Model\Services\EmployeeManager" ["Company\Interfaces\EmployeeDaoInterface"]=> string(29) "Company\Model\Dao\EmployeeDao" ["Company\Interfaces\ContractManagerInterface"]=> string(38) "Company\Model\Services\ContractManager" ["Company\Interfaces\ContractDaoInterface"]=> string(29) "Company\Model\Dao\ContractDao" ["Company\Interfaces\ContractTypeManagerInterface"]=> string(42) "Company\Model\Services\ContractTypeManager" ["Company\Interfaces\ContractTypeDaoInterface"]=> string(33) "Company\Model\Dao\ContractTypeDao" ["Contact\Interfaces\ContactManagerInterface"]=> string(37) "Contact\Model\Services\ContactManager" ["Contact\Interfaces\ContactDaoInterface"]=> string(28) "Contact\Model\Dao\ContactDao" ["Contact\Interfaces\ContactAnswerManagerInterface"]=> string(43) "Contact\Model\Services\ContactAnswerManager" ["Contact\Interfaces\ContactAnswerDaoInterface"]=> string(34) "Contact\Model\Dao\ContactAnswerDao" ["Contact\Interfaces\ContactCommentManagerInterface"]=> string(44) "Contact\Model\Services\ContactCommentManager" ["Contact\Interfaces\ContactCommentDaoInterface"]=> string(35) "Contact\Model\Dao\ContactCommentDao" ["Contact\Interfaces\ContactStatusManagerInterface"]=> string(43) "Contact\Model\Services\ContactStatusManager" ["Contact\Interfaces\ContactStatusDaoInterface"]=> string(34) "Contact\Model\Dao\ContactStatusDao" ["Galleries\Interfaces\GalleryManagerInterface"]=> string(39) "Galleries\Model\Services\GalleryManager" ["Galleries\Interfaces\GalleryDaoInterface"]=> string(30) "Galleries\Model\Dao\GalleryDao" ["Galleries\Interfaces\ItemManagerInterface"]=> string(36) "Galleries\Model\Services\ItemManager" ["Galleries\Interfaces\ItemDaoInterface"]=> string(27) "Galleries\Model\Dao\ItemDao" ["Galleries\Interfaces\ItemTypeManagerInterface"]=> string(40) "Galleries\Model\Services\ItemTypeManager" ["Galleries\Interfaces\ItemTypeDaoInterface"]=> string(31) "Galleries\Model\Dao\ItemTypeDao" ["Galleries\Interfaces\ItemCommentManagerInterface"]=> string(43) "Galleries\Model\Services\ItemCommentManager" ["Galleries\Interfaces\ItemCommentDaoInterface"]=> string(34) "Galleries\Model\Dao\ItemCommentDao" ["Logs\Interfaces\LogManagerInterface"]=> string(30) "Logs\Model\Services\LogManager" ["Logs\Interfaces\LogDaoInterface"]=> string(21) "Logs\Model\Dao\LogDao" ["Menu\Interfaces\MenuManagerInterface"]=> string(31) "Menu\Model\Services\MenuManager" ["Menu\Interfaces\MenuDaoInterface"]=> string(22) "Menu\Model\Dao\MenuDao" ["Menu\Interfaces\MenuItemManagerInterface"]=> string(35) "Menu\Model\Services\MenuItemManager" ["Menu\Interfaces\MenuItemDaoInterface"]=> string(26) "Menu\Model\Dao\MenuItemDao" ["Widget\Interfaces\WidgetManagerInterface"]=> string(35) "Widget\Model\Services\WidgetManager" ["Widget\Interfaces\WidgetDaoInterface"]=> string(26) "Widget\Model\Dao\WidgetDao" ["Widget\Interfaces\WidgetPositionManagerInterface"]=> string(43) "Widget\Model\Services\WidgetPositionManager" ["Widget\Interfaces\WidgetPositionDaoInterface"]=> string(34) "Widget\Model\Dao\WidgetPositionDao" ["Products\Interfaces\ProductManagerInterface"]=> string(38) "Products\Model\Services\ProductManager" ["Products\Interfaces\ProductDaoInterface"]=> string(29) "Products\Model\Dao\ProductDao" ["Products\Interfaces\CategoryManagerInterface"]=> string(39) "Products\Model\Services\CategoryManager" ["Products\Interfaces\CategoryDaoInterface"]=> string(30) "Products\Model\Dao\CategoryDao" ["Products\Interfaces\ProductTypeManagerInterface"]=> string(42) "Products\Model\Services\ProductTypeManager" ["Products\Interfaces\ProductTypeDaoInterface"]=> string(33) "Products\Model\Dao\ProductTypeDao" ["Products\Interfaces\BrandManagerInterface"]=> string(36) "Products\Model\Services\BrandManager" ["Products\Interfaces\BrandDaoInterface"]=> string(27) "Products\Model\Dao\BrandDao" ["Products\Interfaces\CriteriaManagerInterface"]=> string(39) "Products\Model\Services\CriteriaManager" ["Products\Interfaces\CriteriaDaoInterface"]=> string(30) "Products\Model\Dao\CriteriaDao" ["Shop\Interfaces\ShopManagerInterface"]=> string(31) "Shop\Model\Services\ShopManager" ["Shop\Interfaces\ShopDaoInterface"]=> string(22) "Shop\Model\Dao\ShopDao" ["Shop\Interfaces\ShopProductManagerInterface"]=> string(38) "Shop\Model\Services\ShopProductManager" ["Shop\Interfaces\ShopProductDaoInterface"]=> string(29) "Shop\Model\Dao\ShopProductDao" ["Shop\Interfaces\CategoryManagerInterface"]=> string(35) "Shop\Model\Services\CategoryManager" ["Shop\Interfaces\CategoryDaoInterface"]=> string(26) "Shop\Model\Dao\CategoryDao" ["Shop\Interfaces\OrderManagerInterface"]=> string(32) "Shop\Model\Services\OrderManager" ["Shop\Interfaces\OrderDaoInterface"]=> string(23) "Shop\Model\Dao\OrderDao" ["Shop\Interfaces\OrderItemManagerInterface"]=> string(36) "Shop\Model\Services\OrderItemManager" ["Shop\Interfaces\OrderItemDaoInterface"]=> string(27) "Shop\Model\Dao\OrderItemDao" ["Shop\Interfaces\TaxManagerInterface"]=> string(30) "Shop\Model\Services\TaxManager" ["Shop\Interfaces\TaxDaoInterface"]=> string(21) "Shop\Model\Dao\TaxDao" ["Shop\Interfaces\TaxGroupManagerInterface"]=> string(35) "Shop\Model\Services\TaxGroupManager" ["Shop\Interfaces\TaxGroupDaoInterface"]=> string(26) "Shop\Model\Dao\TaxGroupDao" ["Shop\Interfaces\TaxRuleManagerInterface"]=> string(34) "Shop\Model\Services\TaxRuleManager" ["Shop\Interfaces\TaxRuleDaoInterface"]=> string(25) "Shop\Model\Dao\TaxRuleDao" ["Shop\Interfaces\PriceTableManagerInterface"]=> string(37) "Shop\Model\Services\PriceTableManager" ["Shop\Interfaces\PriceTableDaoInterface"]=> string(28) "Shop\Model\Dao\PriceTableDao" ["Shop\Interfaces\PriceTableConditionnementManagerInterface"]=> string(52) "Shop\Model\Services\PriceTableConditionnementManager" ["Shop\Interfaces\PriceTableConditionnementDaoInterface"]=> string(43) "Shop\Model\Dao\PriceTableConditionnementDao" ["Shop\Interfaces\WishListManagerInterface"]=> string(35) "Shop\Model\Services\WishListManager" ["Shop\Interfaces\WishListDaoInterface"]=> string(26) "Shop\Model\Dao\WishListDao" ["Shop\Interfaces\PromotionManagerInterface"]=> string(36) "Shop\Model\Services\PromotionManager" ["Shop\Interfaces\PromotionDaoInterface"]=> string(27) "Shop\Model\Dao\PromotionDao" ["Shop\Interfaces\PromotionItemManagerInterface"]=> string(40) "Shop\Model\Services\PromotionItemManager" ["Shop\Interfaces\PromotionItemDaoInterface"]=> string(31) "Shop\Model\Dao\PromotionItemDao" ["Shop\Interfaces\CartManagerInterface"]=> string(31) "Shop\Model\Services\CartManager" ["Shop\Interfaces\CartDaoInterface"]=> string(22) "Shop\Model\Dao\CartDao" ["Shop\Interfaces\CartItemManagerInterface"]=> string(35) "Shop\Model\Services\CartItemManager" ["Shop\Interfaces\CartItemDaoInterface"]=> string(26) "Shop\Model\Dao\CartItemDao" ["Shop\Interfaces\CartConstraintManagerInterface"]=> string(41) "Shop\Model\Services\CartConstraintManager" ["Shop\Interfaces\CartConstraintDaoInterface"]=> string(32) "Shop\Model\Dao\CartConstraintDao" ["Shop\Interfaces\CartRuleManagerInterface"]=> string(35) "Shop\Model\Services\CartRuleManager" ["Shop\Interfaces\CartRuleDaoInterface"]=> string(26) "Shop\Model\Dao\CartRuleDao" ["Shop\Interfaces\CartRuleRestrictionManagerInterface"]=> string(46) "Shop\Model\Services\CartRuleRestrictionManager" ["Shop\Interfaces\CartRuleRestrictionDaoInterface"]=> string(37) "Shop\Model\Dao\CartRuleRestrictionDao" ["Shop\Interfaces\OrderCartRuleManagerInterface"]=> string(40) "Shop\Model\Services\OrderCartRuleManager" ["Shop\Interfaces\OrderCartRuleDaoInterface"]=> string(31) "Shop\Model\Dao\OrderCartRuleDao" ["Shop\Interfaces\OrderCartRuleRestrictionManagerInterface"]=> string(51) "Shop\Model\Services\OrderCartRuleRestrictionManager" ["Shop\Interfaces\OrderCartRuleRestrictionDaoInterface"]=> string(42) "Shop\Model\Dao\OrderCartRuleRestrictionDao" ["Payments\Interfaces\PaymentManagerInterface"]=> string(38) "Payments\Model\Services\PaymentManager" ["Payments\Interfaces\PaymentDaoInterface"]=> string(29) "Payments\Model\Dao\PaymentDao" ["Payments\Interfaces\PaymentTypeManagerInterface"]=> string(42) "Payments\Model\Services\PaymentTypeManager" ["Payments\Interfaces\PaymentTypeDaoInterface"]=> string(33) "Payments\Model\Dao\PaymentTypeDao" ["Testimonials\Interfaces\TestimonialManagerInterface"]=> string(46) "Testimonials\Model\Services\TestimonialManager" ["Testimonials\Interfaces\TestimonialDaoInterface"]=> string(37) "Testimonials\Model\Dao\TestimonialDao" ["Checkout\Interfaces\PaymentManagerInterface"]=> string(38) "Checkout\Model\Services\PaymentManager" } } ["laminas-cli"]=> array(0) { } ["controller_plugins"]=> array(2) { ["aliases"]=> array(25) { ["identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Laminas\Mvc\Controller\Plugin\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Zend\Mvc\Controller\Plugin\Identity"]=> string(38) "Laminas\Mvc\Controller\Plugin\Identity" ["Zend\Mvc\Plugin\Identity\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["fileprg"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filepostredirectget"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Laminas\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Zend\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(49) "Laminas\Mvc\Controller\Plugin\FilePostRedirectGet" ["Zend\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["prg"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postredirectget"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Laminas\Mvc\Controller\Plugin\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Zend\Mvc\Controller\Plugin\PostRedirectGet"]=> string(45) "Laminas\Mvc\Controller\Plugin\PostRedirectGet" ["Zend\Mvc\Plugin\Prg\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["flashmessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["flashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Laminas\Mvc\Controller\Plugin\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Zend\Mvc\Controller\Plugin\FlashMessenger"]=> string(44) "Laminas\Mvc\Controller\Plugin\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" } ["factories"]=> array(4) { ["Laminas\Mvc\Plugin\Identity\Identity"]=> string(43) "Laminas\Mvc\Plugin\Identity\IdentityFactory" ["Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\Prg\PostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["input_filters"]=> array(1) { ["abstract_factories"]=> array(1) { [0]=> string(53) "Laminas\InputFilter\InputFilterAbstractServiceFactory" } } ["route_manager"]=> array(0) { } ["router"]=> array(1) { ["routes"]=> array(14) { ["home"]=> array(2) { ["type"]=> string(27) "Laminas\Router\Http\Literal" ["options"]=> array(2) { ["route"]=> string(1) "/" ["defaults"]=> array(2) { ["controller"]=> string(20) "Core\Controller\Core" ["action"]=> string(5) "index" } } } ["core.cron.xmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontasks/xmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(10) "xmlsitemap" } } } ["core.cron.mlxmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(23) "/crontasks/mlxmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(12) "mlxmlsitemap" } } } ["core.form.checkunique"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/check-unique-ajax" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "checkunique" } } } ["core.empty"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontask/executeonce" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "executeonce" } } } ["core.crypt.smtppass"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(25) "/bwt_tools/crypt/smtppass" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(13) "cryptsmtppass" } } } ["core.account.activation.email"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(22) "/user/activation/email" ["defaults"]=> array(2) { ["controller"]=> string(30) "Core\Controller\CoreController" ["action"]=> string(32) "resenduseraccountactivationemail" } } } ["search.cron.indexation"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(27) "/crontasks/searchindexation" ["defaults"]=> array(2) { ["controller"]=> string(28) "Search\Controller\IndexAdmin" ["action"]=> string(12) "rebuildindex" } } } ["search.search"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(12) "/search-ajax" ["defaults"]=> array(2) { ["controller"]=> string(24) "Search\Controller\Search" ["action"]=> string(10) "searchajax" } } } ["shop.order.tocart"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/shop/order/tocart" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(11) "ordertocart" } } } ["shop.order.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.en.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/en/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.fr.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/fr/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["checkout.hook.backurl"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/checkout/bkurl" ["defaults"]=> array(2) { ["controller"]=> string(37) "Checkout\Controller\PaymentController" ["action"]=> string(7) "backurl" } } } } } ["view_helpers"]=> array(2) { ["aliases"]=> array(222) { ["form"]=> string(29) "Laminas\Form\View\Helper\Form" ["Form"]=> string(29) "Laminas\Form\View\Helper\Form" ["formbutton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["form_button"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["FormButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formcaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["form_captcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["formCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["FormCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["captchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha/dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["CaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formcaptchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["form_captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["FormCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha/figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["CaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formcaptchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["form_captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["FormCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha/image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["CaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formcaptchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["form_captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["FormCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha/recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["CaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcaptcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["form_captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["FormCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["form_checkbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["FormCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formcollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["form_collection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["FormCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formcolor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["form_color"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["FormColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formdate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["form_date"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["FormDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formdatetime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["form_date_time"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["FormDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formdatetimelocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["form_date_time_local"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["FormDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formdatetimeselect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["form_date_time_select"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["FormDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formdateselect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_date_select"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["formDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["FormDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_element"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formelement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["FormElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["form_element_errors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formelementerrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["FormElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["form_email"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formemail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["FormEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["form_file"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["FormFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfileapcprogress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["form_file_apc_progress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["FormFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formfilesessionprogress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["form_file_session_progress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["FormFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formfileuploadprogress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["form_file_upload_progress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["FormFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formhidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["form_hidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["FormHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formimage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["form_image"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["formImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["FormImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["forminput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["form_input"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["FormInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formlabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["form_label"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["FormLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formmonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["form_month"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["FormMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formmonthselect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["form_month_select"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["FormMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formmulticheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["form_multi_checkbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["FormMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formnumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["form_number"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["FormNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formpassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["form_password"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["FormPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formradio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["form_radio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["FormRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formrange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["form_range"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["FormRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formreset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["form_reset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["FormReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formrow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["form_row"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["FormRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formsearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["form_search"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["FormSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formselect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["form_select"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["FormSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formsubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["form_submit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["FormSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formtel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["form_tel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["FormTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formtext"]=> string(33) "Laminas\Form\View\Helper\FormText" ["form_text"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["FormText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formtextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["form_text_area"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["FormTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formtime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["form_time"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["FormTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formurl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["form_url"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["FormUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formweek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["form_week"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["formWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["FormWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["flashmessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["flashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["zendviewhelperflashmessenger"]=> string(31) "laminasviewhelperflashmessenger" ["currencyformat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["currencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["dateformat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["dateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["numberformat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["numberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["translateplural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["translatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["Zend\I18n\View\Helper\CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["Zend\I18n\View\Helper\DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["Zend\I18n\View\Helper\NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["Zend\I18n\View\Helper\Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Zend\I18n\View\Helper\Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Zend\I18n\View\Helper\TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" } ["factories"]=> array(52) { ["Laminas\Form\View\Helper\Form"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormButton"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Dumb"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Figlet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Image"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\ReCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCollection"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormColor"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeLocal"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElement"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElementErrors"]=> string(57) "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory" ["Laminas\Form\View\Helper\FormEmail"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormFile"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileApcProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileSessionProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileUploadProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormHidden"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormImage"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormInput"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormLabel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonth"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonthSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMultiCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormPassword"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRadio"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRange"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormReset"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRow"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSearch"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSubmit"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormText"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTextarea"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormUrl"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormWeek"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["laminasviewhelperflashmessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["Laminas\I18n\View\Helper\CurrencyFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\DateFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Plural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Translate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\TranslatePlural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["filters"]=> array(2) { ["aliases"]=> array(14) { ["alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["numberformat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberparse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["numberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["Zend\I18n\Filter\Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Zend\I18n\Filter\Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Zend\I18n\Filter\NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["Zend\I18n\Filter\NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" } ["factories"]=> array(4) { ["Laminas\I18n\Filter\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberParse"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["validators"]=> array(2) { ["aliases"]=> array(30) { ["alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["datetime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["dateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isfloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isint"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["phonenumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["phoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["postcode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["postCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["Zend\I18n\Validator\Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Zend\I18n\Validator\Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Zend\I18n\Validator\DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["Zend\I18n\Validator\IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Zend\I18n\Validator\IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Zend\I18n\Validator\PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["Zend\I18n\Validator\PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" } ["factories"]=> array(7) { ["Laminas\I18n\Validator\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\DateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsFloat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsInt"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PhoneNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PostCode"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["controllers"]=> array(2) { ["factories"]=> array(232) { ["Core\Controller\CoreController"]=> string(45) "Core\Factory\Controller\CoreControllerFactory" ["Core\Controller\AdminController"]=> string(46) "Core\Factory\Controller\AdminControllerFactory" ["Core\Controller\AddressController"]=> string(48) "Core\Factory\Controller\AddressControllerFactory" ["Core\Controller\AddressAdminController"]=> string(53) "Core\Factory\Controller\AddressAdminControllerFactory" ["Core\Controller\AddressTypeController"]=> string(52) "Core\Factory\Controller\AddressTypeControllerFactory" ["Core\Controller\AddressTypeAdminController"]=> string(57) "Core\Factory\Controller\AddressTypeAdminControllerFactory" ["Core\Controller\AjaxRightController"]=> string(50) "Core\Factory\Controller\AjaxRightControllerFactory" ["Core\Controller\AjaxRightAdminController"]=> string(55) "Core\Factory\Controller\AjaxRightAdminControllerFactory" ["Core\Controller\BankController"]=> string(45) "Core\Factory\Controller\BankControllerFactory" ["Core\Controller\BankAdminController"]=> string(50) "Core\Factory\Controller\BankAdminControllerFactory" ["Core\Controller\BankAccountController"]=> string(52) "Core\Factory\Controller\BankAccountControllerFactory" ["Core\Controller\BankAccountAdminController"]=> string(57) "Core\Factory\Controller\BankAccountAdminControllerFactory" ["Core\Controller\BankAddressController"]=> string(52) "Core\Factory\Controller\BankAddressControllerFactory" ["Core\Controller\BankAddressAdminController"]=> string(57) "Core\Factory\Controller\BankAddressAdminControllerFactory" ["Core\Controller\CertificateController"]=> string(52) "Core\Factory\Controller\CertificateControllerFactory" ["Core\Controller\CertificateAdminController"]=> string(57) "Core\Factory\Controller\CertificateAdminControllerFactory" ["Core\Controller\ClosedDayController"]=> string(50) "Core\Factory\Controller\ClosedDayControllerFactory" ["Core\Controller\ClosedDayAdminController"]=> string(55) "Core\Factory\Controller\ClosedDayAdminControllerFactory" ["Core\Controller\ClosedDayTypeController"]=> string(54) "Core\Factory\Controller\ClosedDayTypeControllerFactory" ["Core\Controller\ClosedDayTypeAdminController"]=> string(59) "Core\Factory\Controller\ClosedDayTypeAdminControllerFactory" ["Core\Controller\CmsListController"]=> string(48) "Core\Factory\Controller\CmsListControllerFactory" ["Core\Controller\CmsListAdminController"]=> string(53) "Core\Factory\Controller\CmsListAdminControllerFactory" ["Core\Controller\CmsListItemController"]=> string(52) "Core\Factory\Controller\CmsListItemControllerFactory" ["Core\Controller\CmsListItemAdminController"]=> string(57) "Core\Factory\Controller\CmsListItemAdminControllerFactory" ["Core\Controller\ContentController"]=> string(48) "Core\Factory\Controller\ContentControllerFactory" ["Core\Controller\ContentAdminController"]=> string(53) "Core\Factory\Controller\ContentAdminControllerFactory" ["Core\Controller\CmsObjectController"]=> string(50) "Core\Factory\Controller\CmsObjectControllerFactory" ["Core\Controller\CmsObjectAdminController"]=> string(55) "Core\Factory\Controller\CmsObjectAdminControllerFactory" ["Core\Controller\CmsObjectTypeController"]=> string(54) "Core\Factory\Controller\CmsObjectTypeControllerFactory" ["Core\Controller\CmsObjectTypeAdminController"]=> string(59) "Core\Factory\Controller\CmsObjectTypeAdminControllerFactory" ["Core\Controller\CmsObjectPropertyController"]=> string(58) "Core\Factory\Controller\CmsObjectPropertyControllerFactory" ["Core\Controller\CmsObjectPropertyAdminController"]=> string(63) "Core\Factory\Controller\CmsObjectPropertyAdminControllerFactory" ["Core\Controller\CmsObjectPropertyTypeController"]=> string(62) "Core\Factory\Controller\CmsObjectPropertyTypeControllerFactory" ["Core\Controller\CmsObjectPropertyTypeAdminController"]=> string(67) "Core\Factory\Controller\CmsObjectPropertyTypeAdminControllerFactory" ["Core\Controller\CmsUserController"]=> string(48) "Core\Factory\Controller\CmsUserControllerFactory" ["Core\Controller\CmsUserAdminController"]=> string(53) "Core\Factory\Controller\CmsUserAdminControllerFactory" ["Core\Controller\ControllerActionController"]=> string(57) "Core\Factory\Controller\ControllerActionControllerFactory" ["Core\Controller\ControllerActionAdminController"]=> string(62) "Core\Factory\Controller\ControllerActionAdminControllerFactory" ["Core\Controller\ControllerActionTemplateController"]=> string(65) "Core\Factory\Controller\ControllerActionTemplateControllerFactory" ["Core\Controller\ControllerActionTemplateAdminController"]=> string(70) "Core\Factory\Controller\ControllerActionTemplateAdminControllerFactory" ["Core\Controller\CurrencyController"]=> string(49) "Core\Factory\Controller\CurrencyControllerFactory" ["Core\Controller\CurrencyAdminController"]=> string(54) "Core\Factory\Controller\CurrencyAdminControllerFactory" ["Core\Controller\CityController"]=> string(45) "Core\Factory\Controller\CityControllerFactory" ["Core\Controller\CityAdminController"]=> string(50) "Core\Factory\Controller\CityAdminControllerFactory" ["Core\Controller\ContinentController"]=> string(50) "Core\Factory\Controller\ContinentControllerFactory" ["Core\Controller\ContinentAdminController"]=> string(55) "Core\Factory\Controller\ContinentAdminControllerFactory" ["Core\Controller\CountryController"]=> string(48) "Core\Factory\Controller\CountryControllerFactory" ["Core\Controller\CountryAdminController"]=> string(53) "Core\Factory\Controller\CountryAdminControllerFactory" ["Core\Controller\DebugIpController"]=> string(48) "Core\Factory\Controller\DebugIpControllerFactory" ["Core\Controller\DebugIpAdminController"]=> string(53) "Core\Factory\Controller\DebugIpAdminControllerFactory" ["Core\Controller\DeliveryTypeController"]=> string(53) "Core\Factory\Controller\DeliveryTypeControllerFactory" ["Core\Controller\DeliveryTypeAdminController"]=> string(58) "Core\Factory\Controller\DeliveryTypeAdminControllerFactory" ["Core\Controller\EmailController"]=> string(46) "Core\Factory\Controller\EmailControllerFactory" ["Core\Controller\EmailAdminController"]=> string(51) "Core\Factory\Controller\EmailAdminControllerFactory" ["Core\Controller\EmailTypeController"]=> string(50) "Core\Factory\Controller\EmailTypeControllerFactory" ["Core\Controller\EmailTypeAdminController"]=> string(55) "Core\Factory\Controller\EmailTypeAdminControllerFactory" ["Core\Controller\EntityRightController"]=> string(52) "Core\Factory\Controller\EntityRightControllerFactory" ["Core\Controller\EntityRightAdminController"]=> string(57) "Core\Factory\Controller\EntityRightAdminControllerFactory" ["Core\Controller\ExtranetUserController"]=> string(53) "Core\Factory\Controller\ExtranetUserControllerFactory" ["Core\Controller\ExtranetUserAdminController"]=> string(58) "Core\Factory\Controller\ExtranetUserAdminControllerFactory" ["Core\Controller\FormController"]=> string(45) "Core\Factory\Controller\FormControllerFactory" ["Core\Controller\FormAdminController"]=> string(50) "Core\Factory\Controller\FormAdminControllerFactory" ["Core\Controller\FormFieldsetController"]=> string(53) "Core\Factory\Controller\FormFieldsetControllerFactory" ["Core\Controller\FormFieldsetAdminController"]=> string(58) "Core\Factory\Controller\FormFieldsetAdminControllerFactory" ["Core\Controller\FormFieldController"]=> string(50) "Core\Factory\Controller\FormFieldControllerFactory" ["Core\Controller\FormFieldAdminController"]=> string(55) "Core\Factory\Controller\FormFieldAdminControllerFactory" ["Core\Controller\LanguageController"]=> string(49) "Core\Factory\Controller\LanguageControllerFactory" ["Core\Controller\LanguageAdminController"]=> string(54) "Core\Factory\Controller\LanguageAdminControllerFactory" ["Core\Controller\LibraryController"]=> string(48) "Core\Factory\Controller\LibraryControllerFactory" ["Core\Controller\LibraryAdminController"]=> string(53) "Core\Factory\Controller\LibraryAdminControllerFactory" ["Core\Controller\LibraryTypeController"]=> string(52) "Core\Factory\Controller\LibraryTypeControllerFactory" ["Core\Controller\LibraryTypeAdminController"]=> string(57) "Core\Factory\Controller\LibraryTypeAdminControllerFactory" ["Core\Controller\LibraryItemController"]=> string(52) "Core\Factory\Controller\LibraryItemControllerFactory" ["Core\Controller\LibraryItemAdminController"]=> string(57) "Core\Factory\Controller\LibraryItemAdminControllerFactory" ["Core\Controller\LibraryItemTypeController"]=> string(56) "Core\Factory\Controller\LibraryItemTypeControllerFactory" ["Core\Controller\LibraryItemTypeAdminController"]=> string(61) "Core\Factory\Controller\LibraryItemTypeAdminControllerFactory" ["Core\Controller\MessageController"]=> string(48) "Core\Factory\Controller\MessageControllerFactory" ["Core\Controller\MessageAdminController"]=> string(53) "Core\Factory\Controller\MessageAdminControllerFactory" ["Core\Controller\ModuleController"]=> string(47) "Core\Factory\Controller\ModuleControllerFactory" ["Core\Controller\ModuleAdminController"]=> string(52) "Core\Factory\Controller\ModuleAdminControllerFactory" ["Core\Controller\ModuleParameterController"]=> string(56) "Core\Factory\Controller\ModuleParameterControllerFactory" ["Core\Controller\ModuleParameterAdminController"]=> string(61) "Core\Factory\Controller\ModuleParameterAdminControllerFactory" ["Core\Controller\PageController"]=> string(45) "Core\Factory\Controller\PageControllerFactory" ["Core\Controller\PageAdminController"]=> string(50) "Core\Factory\Controller\PageAdminControllerFactory" ["Core\Controller\PersonController"]=> string(47) "Core\Factory\Controller\PersonControllerFactory" ["Core\Controller\PersonAdminController"]=> string(52) "Core\Factory\Controller\PersonAdminControllerFactory" ["Core\Controller\PersonRelationController"]=> string(55) "Core\Factory\Controller\PersonRelationControllerFactory" ["Core\Controller\PersonRelationAdminController"]=> string(60) "Core\Factory\Controller\PersonRelationAdminControllerFactory" ["Core\Controller\PhoneController"]=> string(46) "Core\Factory\Controller\PhoneControllerFactory" ["Core\Controller\PhoneAdminController"]=> string(51) "Core\Factory\Controller\PhoneAdminControllerFactory" ["Core\Controller\PhoneTypeController"]=> string(50) "Core\Factory\Controller\PhoneTypeControllerFactory" ["Core\Controller\PhoneTypeAdminController"]=> string(55) "Core\Factory\Controller\PhoneTypeAdminControllerFactory" ["Core\Controller\RightController"]=> string(46) "Core\Factory\Controller\RightControllerFactory" ["Core\Controller\RightAdminController"]=> string(51) "Core\Factory\Controller\RightAdminControllerFactory" ["Core\Controller\RoleController"]=> string(45) "Core\Factory\Controller\RoleControllerFactory" ["Core\Controller\RoleAdminController"]=> string(50) "Core\Factory\Controller\RoleAdminControllerFactory" ["Core\Controller\RoleTypeController"]=> string(49) "Core\Factory\Controller\RoleTypeControllerFactory" ["Core\Controller\RoleTypeAdminController"]=> string(54) "Core\Factory\Controller\RoleTypeAdminControllerFactory" ["Core\Controller\RouteController"]=> string(46) "Core\Factory\Controller\RouteControllerFactory" ["Core\Controller\RouteAdminController"]=> string(51) "Core\Factory\Controller\RouteAdminControllerFactory" ["Core\Controller\ShortUrlController"]=> string(49) "Core\Factory\Controller\ShortUrlControllerFactory" ["Core\Controller\ShortUrlAdminController"]=> string(54) "Core\Factory\Controller\ShortUrlAdminControllerFactory" ["Core\Controller\SiteController"]=> string(45) "Core\Factory\Controller\SiteControllerFactory" ["Core\Controller\SiteAdminController"]=> string(50) "Core\Factory\Controller\SiteAdminControllerFactory" ["Core\Controller\SiteDomainController"]=> string(51) "Core\Factory\Controller\SiteDomainControllerFactory" ["Core\Controller\SiteDomainAdminController"]=> string(56) "Core\Factory\Controller\SiteDomainAdminControllerFactory" ["Core\Controller\StateController"]=> string(46) "Core\Factory\Controller\StateControllerFactory" ["Core\Controller\StateAdminController"]=> string(51) "Core\Factory\Controller\StateAdminControllerFactory" ["Core\Controller\TemplateController"]=> string(49) "Core\Factory\Controller\TemplateControllerFactory" ["Core\Controller\TemplateAdminController"]=> string(54) "Core\Factory\Controller\TemplateAdminControllerFactory" ["Core\Controller\TemplateGroupController"]=> string(54) "Core\Factory\Controller\TemplateGroupControllerFactory" ["Core\Controller\TemplateGroupAdminController"]=> string(59) "Core\Factory\Controller\TemplateGroupAdminControllerFactory" ["Core\Controller\UserController"]=> string(45) "Core\Factory\Controller\UserControllerFactory" ["Core\Controller\UserAdminController"]=> string(50) "Core\Factory\Controller\UserAdminControllerFactory" ["Core\Controller\UserFavoritObjectController"]=> string(58) "Core\Factory\Controller\UserFavoritObjectControllerFactory" ["Core\Controller\UserFavoritObjectAdminController"]=> string(63) "Core\Factory\Controller\UserFavoritObjectAdminControllerFactory" ["Core\Controller\UserRoleController"]=> string(49) "Core\Factory\Controller\UserRoleControllerFactory" ["Core\Controller\UserRoleAdminController"]=> string(54) "Core\Factory\Controller\UserRoleAdminControllerFactory" ["Core\Controller\UserSessionController"]=> string(52) "Core\Factory\Controller\UserSessionControllerFactory" ["Core\Controller\UserSessionAdminController"]=> string(57) "Core\Factory\Controller\UserSessionAdminControllerFactory" ["Core\Controller\UtilityController"]=> string(48) "Core\Factory\Controller\UtilityControllerFactory" ["Core\Controller\WebsiteController"]=> string(48) "Core\Factory\Controller\WebsiteControllerFactory" ["Core\Controller\WebsiteAdminController"]=> string(53) "Core\Factory\Controller\WebsiteAdminControllerFactory" ["Core\Controller\WebsiteTypeController"]=> string(52) "Core\Factory\Controller\WebsiteTypeControllerFactory" ["Core\Controller\WebsiteTypeAdminController"]=> string(57) "Core\Factory\Controller\WebsiteTypeAdminControllerFactory" ["Company\Controller\CompanyModuleController"]=> string(57) "Company\Factory\Controller\CompanyModuleControllerFactory" ["Company\Controller\CompanyController"]=> string(51) "Company\Factory\Controller\CompanyControllerFactory" ["Company\Controller\CompanyAdminController"]=> string(56) "Company\Factory\Controller\CompanyAdminControllerFactory" ["Company\Controller\DomainController"]=> string(50) "Company\Factory\Controller\DomainControllerFactory" ["Company\Controller\DomainAdminController"]=> string(55) "Company\Factory\Controller\DomainAdminControllerFactory" ["Company\Controller\CompanyFunctionController"]=> string(59) "Company\Factory\Controller\CompanyFunctionControllerFactory" ["Company\Controller\CompanyFunctionAdminController"]=> string(64) "Company\Factory\Controller\CompanyFunctionAdminControllerFactory" ["Company\Controller\EmployeeController"]=> string(52) "Company\Factory\Controller\EmployeeControllerFactory" ["Company\Controller\EmployeeAdminController"]=> string(57) "Company\Factory\Controller\EmployeeAdminControllerFactory" ["Company\Controller\ContractController"]=> string(52) "Company\Factory\Controller\ContractControllerFactory" ["Company\Controller\ContractAdminController"]=> string(57) "Company\Factory\Controller\ContractAdminControllerFactory" ["Company\Controller\ContractTypeController"]=> string(56) "Company\Factory\Controller\ContractTypeControllerFactory" ["Company\Controller\ContractTypeAdminController"]=> string(61) "Company\Factory\Controller\ContractTypeAdminControllerFactory" ["Contact\Controller\ContactModuleController"]=> string(57) "Contact\Factory\Controller\ContactModuleControllerFactory" ["Contact\Controller\ContactController"]=> string(51) "Contact\Factory\Controller\ContactControllerFactory" ["Contact\Controller\ContactAdminController"]=> string(56) "Contact\Factory\Controller\ContactAdminControllerFactory" ["Contact\Controller\ContactAnswerController"]=> string(57) "Contact\Factory\Controller\ContactAnswerControllerFactory" ["Contact\Controller\ContactAnswerAdminController"]=> string(62) "Contact\Factory\Controller\ContactAnswerAdminControllerFactory" ["Contact\Controller\ContactCommentController"]=> string(58) "Contact\Factory\Controller\ContactCommentControllerFactory" ["Contact\Controller\ContactCommentAdminController"]=> string(63) "Contact\Factory\Controller\ContactCommentAdminControllerFactory" ["Contact\Controller\ContactStatusController"]=> string(57) "Contact\Factory\Controller\ContactStatusControllerFactory" ["Contact\Controller\ContactStatusAdminController"]=> string(62) "Contact\Factory\Controller\ContactStatusAdminControllerFactory" ["Galleries\Controller\GalleriesModuleController"]=> string(61) "Galleries\Factory\Controller\GalleriesModuleControllerFactory" ["Galleries\Controller\GalleryController"]=> string(53) "Galleries\Factory\Controller\GalleryControllerFactory" ["Galleries\Controller\GalleryAdminController"]=> string(58) "Galleries\Factory\Controller\GalleryAdminControllerFactory" ["Galleries\Controller\ItemController"]=> string(50) "Galleries\Factory\Controller\ItemControllerFactory" ["Galleries\Controller\ItemAdminController"]=> string(55) "Galleries\Factory\Controller\ItemAdminControllerFactory" ["Galleries\Controller\ItemTypeController"]=> string(54) "Galleries\Factory\Controller\ItemTypeControllerFactory" ["Galleries\Controller\ItemTypeAdminController"]=> string(59) "Galleries\Factory\Controller\ItemTypeAdminControllerFactory" ["Galleries\Controller\ItemCommentController"]=> string(57) "Galleries\Factory\Controller\ItemCommentControllerFactory" ["Galleries\Controller\ItemCommentAdminController"]=> string(62) "Galleries\Factory\Controller\ItemCommentAdminControllerFactory" ["Logs\Controller\LogsModuleController"]=> string(51) "Logs\Factory\Controller\LogsModuleControllerFactory" ["Logs\Controller\LogController"]=> string(44) "Logs\Factory\Controller\LogControllerFactory" ["Logs\Controller\LogAdminController"]=> string(49) "Logs\Factory\Controller\LogAdminControllerFactory" ["Menu\Controller\MenuModuleController"]=> string(51) "Menu\Factory\Controller\MenuModuleControllerFactory" ["Menu\Controller\MenuController"]=> string(45) "Menu\Factory\Controller\MenuControllerFactory" ["Menu\Controller\MenuAdminController"]=> string(50) "Menu\Factory\Controller\MenuAdminControllerFactory" ["Menu\Controller\MenuItemController"]=> string(49) "Menu\Factory\Controller\MenuItemControllerFactory" ["Menu\Controller\MenuItemAdminController"]=> string(54) "Menu\Factory\Controller\MenuItemAdminControllerFactory" ["Widget\Controller\WidgetModuleController"]=> string(55) "Widget\Factory\Controller\WidgetModuleControllerFactory" ["Widget\Controller\WidgetController"]=> string(49) "Widget\Factory\Controller\WidgetControllerFactory" ["Widget\Controller\WidgetAdminController"]=> string(54) "Widget\Factory\Controller\WidgetAdminControllerFactory" ["Widget\Controller\WidgetPositionController"]=> string(57) "Widget\Factory\Controller\WidgetPositionControllerFactory" ["Widget\Controller\WidgetPositionAdminController"]=> string(62) "Widget\Factory\Controller\WidgetPositionAdminControllerFactory" ["Search\Controller\SearchController"]=> string(49) "Search\Factory\Controller\SearchControllerFactory" ["Products\Controller\ProductsModuleController"]=> string(59) "Products\Factory\Controller\ProductsModuleControllerFactory" ["Products\Controller\ProductController"]=> string(52) "Products\Factory\Controller\ProductControllerFactory" ["Products\Controller\ProductAdminController"]=> string(57) "Products\Factory\Controller\ProductAdminControllerFactory" ["Products\Controller\CategoryController"]=> string(53) "Products\Factory\Controller\CategoryControllerFactory" ["Products\Controller\CategoryAdminController"]=> string(58) "Products\Factory\Controller\CategoryAdminControllerFactory" ["Products\Controller\ProductTypeController"]=> string(56) "Products\Factory\Controller\ProductTypeControllerFactory" ["Products\Controller\ProductTypeAdminController"]=> string(61) "Products\Factory\Controller\ProductTypeAdminControllerFactory" ["Products\Controller\BrandController"]=> string(50) "Products\Factory\Controller\BrandControllerFactory" ["Products\Controller\BrandAdminController"]=> string(55) "Products\Factory\Controller\BrandAdminControllerFactory" ["Products\Controller\CriteriaController"]=> string(53) "Products\Factory\Controller\CriteriaControllerFactory" ["Products\Controller\CriteriaAdminController"]=> string(58) "Products\Factory\Controller\CriteriaAdminControllerFactory" ["Shop\Controller\ShopModuleController"]=> string(51) "Shop\Factory\Controller\ShopModuleControllerFactory" ["Shop\Controller\ShopController"]=> string(45) "Shop\Factory\Controller\ShopControllerFactory" ["Shop\Controller\ShopAdminController"]=> string(50) "Shop\Factory\Controller\ShopAdminControllerFactory" ["Shop\Controller\ShopProductController"]=> string(52) "Shop\Factory\Controller\ShopProductControllerFactory" ["Shop\Controller\ShopProductAdminController"]=> string(57) "Shop\Factory\Controller\ShopProductAdminControllerFactory" ["Shop\Controller\CategoryController"]=> string(49) "Shop\Factory\Controller\CategoryControllerFactory" ["Shop\Controller\CategoryAdminController"]=> string(54) "Shop\Factory\Controller\CategoryAdminControllerFactory" ["Shop\Controller\OrderController"]=> string(46) "Shop\Factory\Controller\OrderControllerFactory" ["Shop\Controller\OrderAdminController"]=> string(51) "Shop\Factory\Controller\OrderAdminControllerFactory" ["Shop\Controller\OrderItemController"]=> string(50) "Shop\Factory\Controller\OrderItemControllerFactory" ["Shop\Controller\OrderItemAdminController"]=> string(55) "Shop\Factory\Controller\OrderItemAdminControllerFactory" ["Shop\Controller\TaxController"]=> string(44) "Shop\Factory\Controller\TaxControllerFactory" ["Shop\Controller\TaxAdminController"]=> string(49) "Shop\Factory\Controller\TaxAdminControllerFactory" ["Shop\Controller\TaxGroupController"]=> string(49) "Shop\Factory\Controller\TaxGroupControllerFactory" ["Shop\Controller\TaxGroupAdminController"]=> string(54) "Shop\Factory\Controller\TaxGroupAdminControllerFactory" ["Shop\Controller\TaxRuleController"]=> string(48) "Shop\Factory\Controller\TaxRuleControllerFactory" ["Shop\Controller\TaxRuleAdminController"]=> string(53) "Shop\Factory\Controller\TaxRuleAdminControllerFactory" ["Shop\Controller\PriceTableController"]=> string(51) "Shop\Factory\Controller\PriceTableControllerFactory" ["Shop\Controller\PriceTableAdminController"]=> string(56) "Shop\Factory\Controller\PriceTableAdminControllerFactory" ["Shop\Controller\PriceTableConditionnementController"]=> string(66) "Shop\Factory\Controller\PriceTableConditionnementControllerFactory" ["Shop\Controller\PriceTableConditionnementAdminController"]=> string(71) "Shop\Factory\Controller\PriceTableConditionnementAdminControllerFactory" ["Shop\Controller\WishListController"]=> string(49) "Shop\Factory\Controller\WishListControllerFactory" ["Shop\Controller\WishListAdminController"]=> string(54) "Shop\Factory\Controller\WishListAdminControllerFactory" ["Shop\Controller\PromotionController"]=> string(50) "Shop\Factory\Controller\PromotionControllerFactory" ["Shop\Controller\PromotionAdminController"]=> string(55) "Shop\Factory\Controller\PromotionAdminControllerFactory" ["Shop\Controller\PromotionItemController"]=> string(54) "Shop\Factory\Controller\PromotionItemControllerFactory" ["Shop\Controller\PromotionItemAdminController"]=> string(59) "Shop\Factory\Controller\PromotionItemAdminControllerFactory" ["Shop\Controller\CartController"]=> string(45) "Shop\Factory\Controller\CartControllerFactory" ["Shop\Controller\CartAdminController"]=> string(50) "Shop\Factory\Controller\CartAdminControllerFactory" ["Shop\Controller\CartItemController"]=> string(49) "Shop\Factory\Controller\CartItemControllerFactory" ["Shop\Controller\CartItemAdminController"]=> string(54) "Shop\Factory\Controller\CartItemAdminControllerFactory" ["Shop\Controller\CartConstraintController"]=> string(55) "Shop\Factory\Controller\CartConstraintControllerFactory" ["Shop\Controller\CartConstraintAdminController"]=> string(60) "Shop\Factory\Controller\CartConstraintAdminControllerFactory" ["Shop\Controller\CartRuleController"]=> string(49) "Shop\Factory\Controller\CartRuleControllerFactory" ["Shop\Controller\CartRuleAdminController"]=> string(54) "Shop\Factory\Controller\CartRuleAdminControllerFactory" ["Shop\Controller\CartRuleRestrictionController"]=> string(60) "Shop\Factory\Controller\CartRuleRestrictionControllerFactory" ["Shop\Controller\CartRuleRestrictionAdminController"]=> string(65) "Shop\Factory\Controller\CartRuleRestrictionAdminControllerFactory" ["Shop\Controller\OrderCartRuleController"]=> string(54) "Shop\Factory\Controller\OrderCartRuleControllerFactory" ["Shop\Controller\OrderCartRuleAdminController"]=> string(59) "Shop\Factory\Controller\OrderCartRuleAdminControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionController"]=> string(65) "Shop\Factory\Controller\OrderCartRuleRestrictionControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionAdminController"]=> string(70) "Shop\Factory\Controller\OrderCartRuleRestrictionAdminControllerFactory" ["ShopWinBiz\Controller\WinBizController"]=> string(53) "ShopWinBiz\Factory\Controller\WinBizControllerFactory" ["Payments\Controller\PaymentsModuleController"]=> string(59) "Payments\Factory\Controller\PaymentsModuleControllerFactory" ["Payments\Controller\PaymentController"]=> string(52) "Payments\Factory\Controller\PaymentControllerFactory" ["Payments\Controller\PaymentAdminController"]=> string(57) "Payments\Factory\Controller\PaymentAdminControllerFactory" ["Payments\Controller\PaymentTypeController"]=> string(56) "Payments\Factory\Controller\PaymentTypeControllerFactory" ["Payments\Controller\PaymentTypeAdminController"]=> string(61) "Payments\Factory\Controller\PaymentTypeAdminControllerFactory" ["Testimonials\Controller\TestimonialsModuleController"]=> string(67) "Testimonials\Factory\Controller\TestimonialsModuleControllerFactory" ["Testimonials\Controller\TestimonialController"]=> string(60) "Testimonials\Factory\Controller\TestimonialControllerFactory" ["Testimonials\Controller\TestimonialAdminController"]=> string(65) "Testimonials\Factory\Controller\TestimonialAdminControllerFactory" ["Checkout\Controller\PaymentController"]=> string(52) "Checkout\Factory\Controller\PaymentControllerFactory" } ["invokables"]=> array(45) { ["MyFirstPlugin"]=> string(36) "Core\Controller\Plugin\MyFirstPlugin" ["Core\Controller\Core"]=> string(30) "Core\Controller\CoreController" ["Core\Controller\LibraryAdmin"]=> string(38) "Core\Controller\LibraryAdminController" ["Core\Controller\Debug"]=> string(31) "Core\Controller\DebugController" ["Core\Controller\Desktop"]=> string(33) "Core\Controller\DesktopController" ["Core\Controller\Diploma"]=> string(38) "Core\Controller\DiplomaAdminController" ["Core\Controller\UnitTest\CoreUnitTest"]=> string(47) "Core\Controller\UnitTest\CoreUnitTestController" ["Core\Controller\UnitTest\CoreAddressUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreAddressUnitTestController" ["Core\Controller\UnitTest\CoreAddressTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreAddressTypeUnitTestController" ["Core\Controller\UnitTest\CoreAjaxRightUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreAjaxRightUnitTestController" ["Core\Controller\UnitTest\CoreContentUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreContentUnitTestController" ["Core\Controller\UnitTest\CoreCurrencyUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreCurrencyUnitTestController" ["Core\Controller\UnitTest\CoreDeliveryTypeUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreDeliveryTypeUnitTestController" ["Core\Controller\UnitTest\CoreEmailUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreEmailUnitTestController" ["Core\Controller\UnitTest\CoreEmailTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreEmailTypeUnitTestController" ["Core\Controller\UnitTest\CoreFormUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreFormUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreFormFieldUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldsetUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreFormFieldsetUnitTestController" ["Core\Controller\UnitTest\CoreLanguageUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreLanguageUnitTestController" ["Core\Controller\UnitTest\CoreLibraryUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreLibraryUnitTestController" ["Core\Controller\UnitTest\CoreLibraryTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryTypeUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryItemUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemTypeUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreLibraryItemTypeUnitTestController" ["Core\Controller\UnitTest\CoreMessageUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreMessageUnitTestController" ["Core\Controller\UnitTest\CoreModuleUnitTest"]=> string(53) "Core\Controller\UnitTest\CoreModuleUnitTestController" ["Core\Controller\UnitTest\CoreModuleParameterUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreModuleParameterUnitTestController" ["Core\Controller\UnitTest\CorePageUnitTest"]=> string(51) "Core\Controller\UnitTest\CorePageUnitTestController" ["Core\Controller\UnitTest\CorePersonUnitTest"]=> string(53) "Core\Controller\UnitTest\CorePersonUnitTestController" ["Core\Controller\UnitTest\CorePersonRelationUnitTest"]=> string(61) "Core\Controller\UnitTest\CorePersonRelationUnitTestController" ["Core\Controller\UnitTest\CorePhoneUnitTest"]=> string(52) "Core\Controller\UnitTest\CorePhoneUnitTestController" ["Core\Controller\UnitTest\CorePhoneTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CorePhoneTypeUnitTestController" ["Core\Controller\UnitTest\CoreRightUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreRightUnitTestController" ["Core\Controller\UnitTest\CoreRoleUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreRoleUnitTestController" ["Core\Controller\UnitTest\CoreRoleTypeUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreRoleTypeUnitTestController" ["Core\Controller\UnitTest\CoreTemplateUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreTemplateUnitTestController" ["Core\Controller\UnitTest\CoreTemplateGroupUnitTest"]=> string(60) "Core\Controller\UnitTest\CoreTemplateGroupUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreWebsiteUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreWebsiteTypeUnitTestController" ["QRCode\Controller\QRCode"]=> string(34) "QRCode\Controller\QRCodeController" ["QRCode\Controller\QRCodeAdmin"]=> string(39) "QRCode\Controller\QRCodeAdminController" ["QRCode\Controller\Access"]=> string(34) "QRCode\Controller\AccessController" ["QRCode\Controller\AccessAdmin"]=> string(39) "QRCode\Controller\AccessAdminController" ["Search\Controller\Search"]=> string(34) "Search\Controller\SearchController" ["Search\Controller\Index"]=> string(33) "Search\Controller\IndexController" ["Search\Controller\IndexAdmin"]=> string(38) "Search\Controller\IndexAdminController" } } ["translator"]=> array(2) { ["locale"]=> string(5) "fr_FR" ["translation_file_patterns"]=> array(1) { [0]=> array(3) { ["type"]=> string(7) "gettext" ["base_dir"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Core/config/../translations" ["pattern"]=> string(5) "%s.mo" } } } ["view_manager"]=> array(8) { ["doctype"]=> string(5) "HTML5" ["strategies"]=> array(1) { [0]=> string(16) "ViewJsonStrategy" } ["template_path_stack"]=> array(21) { ["core"]=> string(107) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/layouts" ["company"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Company/config/../view" ["shopstructureddata"]=> string(132) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopStructuredData/config/../view" ["contact"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Contact/config/../view" ["galleries"]=> string(123) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Galleries/config/../view" ["logs"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Logs/config/../view" ["menu"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Menu/config/../view" ["qrcode"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/QRCode/config/../view" ["widget"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Widget/config/../view" ["search"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Search/config/../view" ["products"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Products/config/../view" ["shop"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/config/../view" ["shopwinbiz"]=> string(124) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopWinBiz/config/../view" ["payments"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Payments/config/../view" ["testimonials"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Testimonials/config/../view" ["shopanalytics"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopAnalytics/config/../view" ["checkout"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Checkout/config/../view" ["Caveschateauauvernier"]=> string(149) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/specific_site/module/Caveschateauauvernier/config/../view" ["views"]=> string(104) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view" ["layouts"]=> string(117) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas" ["customlayouts"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" } ["template_map"]=> array(3) { ["error/404"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/404.phtml" ["layout/layout"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/500.phtml" ["error/index"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view/core/error/index.phtml" } ["not_found_template"]=> string(9) "error/404" ["exception_template"]=> string(11) "error/index" ["display_not_found_reason"]=> bool(true) ["display_exceptions"]=> bool(true) } ["navigation"]=> array(0) { } ["sentry"]=> array(2) { ["disable_module"]=> bool(false) ["options"]=> array(1) { ["dsn"]=> string(74) "https://0b5c664cafc349c5a5bed8048da6e011@o1176727.ingest.sentry.io/6276660" } } ["cache_rights"]=> bool(false) ["ajaxAdmin"]=> bool(true) ["externalModules"]=> bool(true) ["base_url"]=> string(2) "./" ["debug"]=> bool(true) ["defaultSiteName"]=> string(16) "chateauauvernier" ["defaultSiteId"]=> int(1) ["defaultHost"]=> string(24) "new.chateau-auvernier.ch" ["defaultIp"]=> string(9) "" ["defaultUserGroup"]=> int(1) ["rootPath"]=> string(79) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current" ["publicPath"]=> string(93) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public" ["dataPath"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data" ["applicationPath"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module" ["cssResourcesCachePath"]=> string(103) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/css/cache" ["jsResourcesCachePath"]=> string(102) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/js/cache" ["resourcesExpirationTime"]=> string(29) "Tue, 04 Jul 2023 15:57:49 GMT" ["displaySitenameInUrl"]=> bool(false) ["logging"]=> array(4) { ["enabled"]=> bool(true) ["level"]=> int(3) ["fileName"]=> string(8) "site.log" ["path"]=> string(109) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/logs/chateauauvernier" } ["phpSettings"]=> array(4) { ["max_execution_time"]=> int(600) ["date.timezone"]=> string(13) "Europe/Zurich" ["display_startup_errors"]=> bool(true) ["display_errors"]=> bool(true) } ["db"]=> array(6) { ["driver"]=> string(3) "Pdo" ["dsn"]=> string(68) "mysql:dbname=dlxu_shop_chateauauvernier;host=dlxu.myd.infomaniak.com" ["driver_options"]=> array(3) { [1002]=> string(32) "SET NAMES 'UTF8', sql_mode = '';" [17]=> bool(false) [20]=> bool(false) } ["adapters"]=> array(1) { ["cmsAdapter"]=> array(4) { ["driver"]=> string(3) "Pdo" ["username"]=> string(0) "" ["password"]=> string(0) "" ["dsn"]=> string(19) "mysql:dbname=;host=" } } ["username"]=> string(15) "dlxu_shopdbuser" ["password"]=> string(12) "l_OSuAOz3kqr" } ["cache_path"]=> string(98) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data/cache" ["cache_type"]=> string(10) "filesystem" ["cmsversion"]=> float(4) ["debugemail"]=> bool(false) ["dbdebug"]=> bool(false) ["dev"]=> bool(true) ["templatePath"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" ["templateName"]=> string(9) "shopgrids" ["privatePath"]=> string(87) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private" ["sessionLifeTime"]=> string(4) "1440" } ["init":"Core\Module":private]=> bool(false) ["adminPage":"Core\Module":private]=> bool(false) ["isAjax":"Core\Module":private]=> bool(false) ["acl":"Core\Module":private]=> object(Shop\Model\Services\Override\Acl)#1425 (8) { ["serviceManager":protected]=> *RECURSION* ["redirectTo":protected]=> string(14) "/en/connection" ["roleRegistry":protected]=> NULL ["resources":protected]=> array(0) { } ["isAllowedRole":protected]=> NULL ["isAllowedResource":protected]=> NULL ["isAllowedPrivilege":protected]=> NULL ["rules":protected]=> array(2) { ["allResources"]=> array(2) { ["allRoles"]=> array(2) { ["allPrivileges"]=> array(2) { ["type"]=> string(9) "TYPE_DENY" ["assert"]=> NULL } ["byPrivilegeId"]=> array(0) { } } ["byRoleId"]=> array(0) { } } ["byResourceId"]=> array(0) { } } } ["tmpTest":"Core\Module":private]=> NULL ["initAjax"]=> int(0) } ["parameter"]=> array(1) { ["$sm"]=> string(10) "" } } ["Core\Front\Form\AddressForm"]=> object(Closure)#53 (2) { ["this"]=> object(Core\Module)#50 (11) { ["defaultAdminLanguage":"Core\Module":private]=> string(2) "fr" ["requestedCmsObject":"Core\Module":private]=> object(Core\Model\Domain\CmsObject)#1164 (30) { ["objectId"]=> string(25) "EN_549296cbd43ea385133062" ["parentObjectId"]=> string(25) "EN_548aaba3ef08d749124007" ["objectTypeId"]=> string(1) "2" ["lngUnId"]=> string(22) "549296cbd43ea385133062" ["languageId"]=> string(2) "42" ["siteId"]=> string(1) "1" ["templateId"]=> string(2) "43" ["templateGroupId"]=> string(1) "1" ["last"]=> int(1) ["version"]=> int(1) ["active"]=> int(1) ["url"]=> string(0) "" ["status"]=> int(2) ["statusUserId"]=> string(1) "0" ["deleted"]=> int(0) ["deletedBy"]=> string(1) "0" ["published"]=> int(1) ["publishedBy"]=> string(1) "1" ["creationDate"]=> string(19) "2014-12-18 09:56:43" ["createdBy"]=> string(1) "1" ["updateDate"]=> string(19) "2014-12-18 09:56:43" ["updatedBy"]=> string(1) "1" ["publicationDateFrom"]=> string(19) "0000-00-00 00:00:00" ["publicationDateTo"]=> string(19) "0000-00-00 00:00:00" ["owner"]=> string(1) "1" ["displayOrder"]=> int(0) ["objectUrl"]=> NULL ["objectsFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } ["fieldsMap":protected]=> array(27) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" ["objectUrl"]=> string(10) "object_url" } ["localFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } } ["requestedObject":"Core\Module":private]=> NULL ["requestServerData":"Core\Module":private]=> object(Laminas\Stdlib\Parameters)#610 (1) { ["storage":"ArrayObject":private]=> array(62) { ["TEMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMPDIR"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["ORIG_SCRIPT_NAME"]=> string(19) "/.fpm/php5.external" ["ORIG_PATH_TRANSLATED"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["ORIG_PATH_INFO"]=> string(17) "/public/index.php" ["ORIG_SCRIPT_FILENAME"]=> string(105) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/php5.external" ["SCRIPT_NAME"]=> string(17) "/public/index.php" ["REQUEST_URI"]=> string(58) "/en/shop/detailsen?id=6253d9fcc47bc657111855&catname=wines" ["QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REQUEST_METHOD"]=> string(3) "GET" ["SERVER_PROTOCOL"]=> string(8) "HTTP/1.1" ["GATEWAY_INTERFACE"]=> string(7) "CGI/1.1" ["REDIRECT_QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REDIRECT_URL"]=> string(17) "/public/index.php" ["REMOTE_PORT"]=> string(5) "58056" ["SCRIPT_FILENAME"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["SERVER_ADMIN"]=> string(30) "webmaster@chateau-auvernier.ch" ["CONTEXT_DOCUMENT_ROOT"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/" ["CONTEXT_PREFIX"]=> string(6) "/.fpm/" ["REQUEST_SCHEME"]=> string(5) "https" ["DOCUMENT_ROOT"]=> string(77) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch" ["REMOTE_ADDR"]=> string(33) "2001:1600:4:b:1a66:daff:fe53:6382" ["SERVER_PORT"]=> string(3) "443" ["SERVER_ADDR"]=> string(10) "" ["SERVER_NAME"]=> string(20) "chateau-auvernier.ch" ["SERVER_SOFTWARE"]=> string(6) "Apache" ["SERVER_SIGNATURE"]=> string(0) "" ["PATH"]=> string(60) "/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin" ["HTTP_X_FORWARDED_PROTO"]=> string(5) "https" ["HTTP_CONNECTION"]=> string(5) "close" ["HTTP_X_FORWARDED_SERVER"]=> string(24) "new.chateau-auvernier.ch" ["HTTP_X_FORWARDED_HOST"]=> string(20) "chateau-auvernier.ch" ["HTTP_X_FORWARDED_FOR"]=> string(12) "" ["HTTP_ACCEPT_ENCODING"]=> string(7) "br,gzip" ["HTTP_ACCEPT_LANGUAGE"]=> string(14) "en-US,en;q=0.5" ["HTTP_ACCEPT"]=> string(63) "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8" ["HTTP_USER_AGENT"]=> string(40) "CCBot/2.0 (https://commoncrawl.org/faq/)" ["HTTP_HOST"]=> string(20) "chateau-auvernier.ch" ["PHP_VERSION"]=> string(3) "8.0" ["SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["HTTPS"]=> string(2) "on" ["UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_HANDLER"]=> string(9) "php5-fcgi" ["REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_REDIRECT_proto"]=> string(5) "https" ["REDIRECT_REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["FCGI_ROLE"]=> string(9) "RESPONDER" ["PHP_SELF"]=> string(17) "/public/index.php" ["REQUEST_TIME_FLOAT"]=> float(1656950269.863278) ["REQUEST_TIME"]=> int(1656950269) } } ["config":"Core\Module":private]=> array(45) { ["service_manager"]=> array(4) { ["abstract_factories"]=> array(6) { [0]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [1]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [2]=> string(51) "Laminas\Di\Container\ServiceManager\AutowireFactory" [3]=> string(39) "Laminas\Form\FormAbstractServiceFactory" [4]=> string(59) "Laminas\Navigation\Service\NavigationAbstractServiceFactory" [5]=> string(48) "Laminas\Db\Adapter\AdapterAbstractServiceFactory" } ["factories"]=> array(401) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> string(56) "Laminas\Cache\Service\StorageAdapterPluginManagerFactory" ["Laminas\Cache\Storage\PluginManager"]=> string(49) "Laminas\Cache\Service\StoragePluginManagerFactory" ["Laminas\Cache\Service\StoragePluginFactory"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StoragePluginFactoryInterface"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactory"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactoryInterface"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Di\InjectorInterface"]=> string(36) "Laminas\Di\Container\InjectorFactory" ["Laminas\Di\ConfigInterface"]=> string(34) "Laminas\Di\Container\ConfigFactory" ["Laminas\Di\CodeGenerator\InjectorGenerator"]=> string(37) "Laminas\Di\Container\GeneratorFactory" ["Laminas\Mvc\I18n\Translator"]=> string(34) "Laminas\Mvc\I18n\TranslatorFactory" ["Laminas\InputFilter\InputFilterPluginManager"]=> string(51) "Laminas\InputFilter\InputFilterPluginManagerFactory" ["SerializerAdapterManager"]=> string(46) "Laminas\Serializer\AdapterPluginManagerFactory" ["Laminas\Router\Http\TreeRouteStack"]=> string(37) "Laminas\Router\Http\HttpRouterFactory" ["Laminas\Router\RoutePluginManager"]=> string(40) "Laminas\Router\RoutePluginManagerFactory" ["Laminas\Router\RouteStackInterface"]=> string(28) "Laminas\Router\RouterFactory" ["FormAnnotationBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormAttributeBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormElementManager"]=> string(38) "Laminas\Form\FormElementManagerFactory" ["Laminas\Validator\ValidatorPluginManager"]=> string(47) "Laminas\Validator\ValidatorPluginManagerFactory" ["Laminas\Mail\Protocol\SmtpPluginManager"]=> string(46) "Laminas\Mail\Protocol\SmtpPluginManagerFactory" ["Laminas\I18n\Translator\TranslatorInterface"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["Laminas\I18n\Translator\LoaderPluginManager"]=> string(50) "Laminas\I18n\Translator\LoaderPluginManagerFactory" ["Laminas\Navigation\Navigation"]=> string(51) "Laminas\Navigation\Service\DefaultNavigationFactory" ["main-navigation"]=> string(34) "Core\Factory\MainNavigationFactory" ["admin-navigation"]=> string(39) "Core\Factory\AdminMainNavigationFactory" ["translator"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["CoreManager"]=> string(39) "Core\Factory\Manager\CoreManagerFactory" ["Core\Model\Services\ControllerActionManagerLaminas"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDaoLaminas"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["ControllerActionGatewayLaminas"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\PageManagerLaminas"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDaoLaminas"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["PageGatewayLaminas"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\CmsObjectManager"]=> string(44) "Core\Factory\Manager\CmsObjectManagerFactory" ["Core\Model\Dao\CmsObjectDao"]=> string(36) "Core\Factory\Dao\CmsObjectDaoFactory" ["CmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\AddressManager"]=> string(42) "Core\Factory\Manager\AddressManagerFactory" ["Core\Model\Dao\AddressDao"]=> string(34) "Core\Factory\Dao\AddressDaoFactory" ["CoreAddressGateway"]=> string(42) "Core\Factory\Gateway\AddressGatewayFactory" ["Core\Model\Services\AddressTypeManager"]=> string(46) "Core\Factory\Manager\AddressTypeManagerFactory" ["Core\Model\Dao\AddressTypeDao"]=> string(38) "Core\Factory\Dao\AddressTypeDaoFactory" ["CoreAddressTypeGateway"]=> string(46) "Core\Factory\Gateway\AddressTypeGatewayFactory" ["Core\Model\Services\AjaxRightManager"]=> string(44) "Core\Factory\Manager\AjaxRightManagerFactory" ["Core\Model\Dao\AjaxRightDao"]=> string(36) "Core\Factory\Dao\AjaxRightDaoFactory" ["CoreAjaxRightGateway"]=> string(44) "Core\Factory\Gateway\AjaxRightGatewayFactory" ["Core\Model\Services\BankManager"]=> string(39) "Core\Factory\Manager\BankManagerFactory" ["Core\Model\Dao\BankDao"]=> string(31) "Core\Factory\Dao\BankDaoFactory" ["CoreBankGateway"]=> string(39) "Core\Factory\Gateway\BankGatewayFactory" ["Core\Model\Services\BankAccountManager"]=> string(46) "Core\Factory\Manager\BankAccountManagerFactory" ["Core\Model\Dao\BankAccountDao"]=> string(38) "Core\Factory\Dao\BankAccountDaoFactory" ["CoreBankAccountGateway"]=> string(46) "Core\Factory\Gateway\BankAccountGatewayFactory" ["Core\Model\Services\BankAddressManager"]=> string(46) "Core\Factory\Manager\BankAddressManagerFactory" ["Core\Model\Dao\BankAddressDao"]=> string(38) "Core\Factory\Dao\BankAddressDaoFactory" ["CoreBankAddressGateway"]=> string(46) "Core\Factory\Gateway\BankAddressGatewayFactory" ["Core\Model\Services\CertificateManager"]=> string(46) "Core\Factory\Manager\CertificateManagerFactory" ["Core\Model\Dao\CertificateDao"]=> string(38) "Core\Factory\Dao\CertificateDaoFactory" ["CoreCertificateGateway"]=> string(46) "Core\Factory\Gateway\CertificateGatewayFactory" ["Core\Model\Services\ClosedDayManager"]=> string(44) "Core\Factory\Manager\ClosedDayManagerFactory" ["Core\Model\Dao\ClosedDayDao"]=> string(36) "Core\Factory\Dao\ClosedDayDaoFactory" ["CoreClosedDayGateway"]=> string(44) "Core\Factory\Gateway\ClosedDayGatewayFactory" ["Core\Model\Services\ClosedDayTypeManager"]=> string(48) "Core\Factory\Manager\ClosedDayTypeManagerFactory" ["Core\Model\Dao\ClosedDayTypeDao"]=> string(40) "Core\Factory\Dao\ClosedDayTypeDaoFactory" ["CoreClosedDayTypeGateway"]=> string(48) "Core\Factory\Gateway\ClosedDayTypeGatewayFactory" ["Core\Model\Services\CmsListManager"]=> string(42) "Core\Factory\Manager\CmsListManagerFactory" ["Core\Model\Dao\CmsListDao"]=> string(34) "Core\Factory\Dao\CmsListDaoFactory" ["CoreCmsListGateway"]=> string(42) "Core\Factory\Gateway\CmsListGatewayFactory" ["Core\Model\Services\CmsListItemManager"]=> string(46) "Core\Factory\Manager\CmsListItemManagerFactory" ["Core\Model\Dao\CmsListItemDao"]=> string(38) "Core\Factory\Dao\CmsListItemDaoFactory" ["CoreCmsListItemGateway"]=> string(46) "Core\Factory\Gateway\CmsListItemGatewayFactory" ["Core\Model\Services\ContentManager"]=> string(42) "Core\Factory\Manager\ContentManagerFactory" ["Core\Model\Dao\ContentDao"]=> string(34) "Core\Factory\Dao\ContentDaoFactory" ["CoreContentGateway"]=> string(42) "Core\Factory\Gateway\ContentGatewayFactory" ["CoreCmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["Core\Model\Services\CmsObjectTypeManager"]=> string(48) "Core\Factory\Manager\CmsObjectTypeManagerFactory" ["Core\Model\Dao\CmsObjectTypeDao"]=> string(40) "Core\Factory\Dao\CmsObjectTypeDaoFactory" ["CoreCmsObjectTypeGateway"]=> string(48) "Core\Factory\Gateway\CmsObjectTypeGatewayFactory" ["Core\Model\Services\CmsObjectPropertyManager"]=> string(52) "Core\Factory\Manager\CmsObjectPropertyManagerFactory" ["Core\Model\Dao\CmsObjectPropertyDao"]=> string(44) "Core\Factory\Dao\CmsObjectPropertyDaoFactory" ["CoreCmsObjectPropertyGateway"]=> string(52) "Core\Factory\Gateway\CmsObjectPropertyGatewayFactory" ["Core\Model\Services\CmsObjectPropertyTypeManager"]=> string(56) "Core\Factory\Manager\CmsObjectPropertyTypeManagerFactory" ["Core\Model\Dao\CmsObjectPropertyTypeDao"]=> string(48) "Core\Factory\Dao\CmsObjectPropertyTypeDaoFactory" ["CoreCmsObjectPropertyTypeGateway"]=> string(56) "Core\Factory\Gateway\CmsObjectPropertyTypeGatewayFactory" ["Core\Model\Services\ControllerActionManager"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDao"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["CoreControllerActionGateway"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\ControllerActionTemplateManager"]=> string(59) "Core\Factory\Manager\ControllerActionTemplateManagerFactory" ["Core\Model\Dao\ControllerActionTemplateDao"]=> string(51) "Core\Factory\Dao\ControllerActionTemplateDaoFactory" ["CoreControllerActionTemplateGateway"]=> string(59) "Core\Factory\Gateway\ControllerActionTemplateGatewayFactory" ["Core\Model\Services\CurrencyManager"]=> string(43) "Core\Factory\Manager\CurrencyManagerFactory" ["Core\Model\Dao\CurrencyDao"]=> string(35) "Core\Factory\Dao\CurrencyDaoFactory" ["CoreCurrencyGateway"]=> string(43) "Core\Factory\Gateway\CurrencyGatewayFactory" ["Core\Model\Services\CityManager"]=> string(39) "Core\Factory\Manager\CityManagerFactory" ["Core\Model\Dao\CityDao"]=> string(31) "Core\Factory\Dao\CityDaoFactory" ["CoreCityGateway"]=> string(39) "Core\Factory\Gateway\CityGatewayFactory" ["Core\Model\Services\CmsUserManager"]=> string(42) "Core\Factory\Manager\CmsUserManagerFactory" ["Core\Model\Dao\CmsUserDao"]=> string(34) "Core\Factory\Dao\CmsUserDaoFactory" ["CoreCmsUserGateway"]=> string(42) "Core\Factory\Gateway\CmsUserGatewayFactory" ["Core\Model\Services\ContinentManager"]=> string(44) "Core\Factory\Manager\ContinentManagerFactory" ["Core\Model\Dao\ContinentDao"]=> string(36) "Core\Factory\Dao\ContinentDaoFactory" ["CoreContinentGateway"]=> string(44) "Core\Factory\Gateway\ContinentGatewayFactory" ["Core\Model\Services\CountryManager"]=> string(42) "Core\Factory\Manager\CountryManagerFactory" ["Core\Model\Dao\CountryDao"]=> string(34) "Core\Factory\Dao\CountryDaoFactory" ["CoreCountryGateway"]=> string(42) "Core\Factory\Gateway\CountryGatewayFactory" ["Core\Model\Services\DebugIpManager"]=> string(42) "Core\Factory\Manager\DebugIpManagerFactory" ["Core\Model\Dao\DebugIpDao"]=> string(34) "Core\Factory\Dao\DebugIpDaoFactory" ["CoreDebugIpGateway"]=> string(42) "Core\Factory\Gateway\DebugIpGatewayFactory" ["Core\Model\Services\DeliveryTypeManager"]=> string(47) "Core\Factory\Manager\DeliveryTypeManagerFactory" ["Core\Model\Dao\DeliveryTypeDao"]=> string(39) "Core\Factory\Dao\DeliveryTypeDaoFactory" ["CoreDeliveryTypeGateway"]=> string(47) "Core\Factory\Gateway\DeliveryTypeGatewayFactory" ["Core\Model\Services\EmailManager"]=> string(40) "Core\Factory\Manager\EmailManagerFactory" ["Core\Model\Dao\EmailDao"]=> string(32) "Core\Factory\Dao\EmailDaoFactory" ["CoreEmailGateway"]=> string(40) "Core\Factory\Gateway\EmailGatewayFactory" ["Core\Model\Services\EmailMessageManager"]=> string(47) "Core\Factory\Manager\EmailMessageManagerFactory" ["Core\Model\Dao\EmailMessageDao"]=> string(39) "Core\Factory\Dao\EmailMessageDaoFactory" ["CoreEmailMessageGateway"]=> string(47) "Core\Factory\Gateway\EmailMessageGatewayFactory" ["Core\Model\Services\EmailTypeManager"]=> string(44) "Core\Factory\Manager\EmailTypeManagerFactory" ["Core\Model\Dao\EmailTypeDao"]=> string(36) "Core\Factory\Dao\EmailTypeDaoFactory" ["CoreEmailTypeGateway"]=> string(44) "Core\Factory\Gateway\EmailTypeGatewayFactory" ["Core\Model\Services\EntityRightManager"]=> string(46) "Core\Factory\Manager\EntityRightManagerFactory" ["Core\Model\Dao\EntityRightDao"]=> string(38) "Core\Factory\Dao\EntityRightDaoFactory" ["CoreEntityRightGateway"]=> string(46) "Core\Factory\Gateway\EntityRightGatewayFactory" ["Core\Model\Services\ExtranetUserManager"]=> string(47) "Core\Factory\Manager\ExtranetUserManagerFactory" ["Core\Model\Dao\ExtranetUserDao"]=> string(39) "Shop\Factory\Dao\ExtranetUserDaoFactory" ["CoreExtranetUserGateway"]=> string(47) "Core\Factory\Gateway\ExtranetUserGatewayFactory" ["Core\Model\Services\FormManager"]=> string(39) "Core\Factory\Manager\FormManagerFactory" ["Core\Model\Dao\FormDao"]=> string(31) "Core\Factory\Dao\FormDaoFactory" ["CoreFormGateway"]=> string(39) "Core\Factory\Gateway\FormGatewayFactory" ["Core\Model\Services\FormFieldsetManager"]=> string(47) "Core\Factory\Manager\FormFieldsetManagerFactory" ["Core\Model\Dao\FormFieldsetDao"]=> string(39) "Core\Factory\Dao\FormFieldsetDaoFactory" ["CoreFormFieldsetGateway"]=> string(47) "Core\Factory\Gateway\FormFieldsetGatewayFactory" ["Core\Model\Services\FormFieldManager"]=> string(44) "Core\Factory\Manager\FormFieldManagerFactory" ["Core\Model\Dao\FormFieldDao"]=> string(36) "Core\Factory\Dao\FormFieldDaoFactory" ["CoreFormFieldGateway"]=> string(44) "Core\Factory\Gateway\FormFieldGatewayFactory" ["Core\Model\Services\LanguageManager"]=> string(43) "Core\Factory\Manager\LanguageManagerFactory" ["Core\Model\Dao\LanguageDao"]=> string(35) "Core\Factory\Dao\LanguageDaoFactory" ["CoreLanguageGateway"]=> string(43) "Core\Factory\Gateway\LanguageGatewayFactory" ["Core\Model\Services\LibraryManager"]=> string(42) "Core\Factory\Manager\LibraryManagerFactory" ["Core\Model\Dao\LibraryDao"]=> string(34) "Core\Factory\Dao\LibraryDaoFactory" ["CoreLibraryGateway"]=> string(42) "Core\Factory\Gateway\LibraryGatewayFactory" ["Core\Model\Services\LibraryTypeManager"]=> string(46) "Core\Factory\Manager\LibraryTypeManagerFactory" ["Core\Model\Dao\LibraryTypeDao"]=> string(38) "Core\Factory\Dao\LibraryTypeDaoFactory" ["CoreLibraryTypeGateway"]=> string(46) "Core\Factory\Gateway\LibraryTypeGatewayFactory" ["Core\Model\Services\LibraryItemManager"]=> string(46) "Core\Factory\Manager\LibraryItemManagerFactory" ["Core\Model\Dao\LibraryItemDao"]=> string(38) "Core\Factory\Dao\LibraryItemDaoFactory" ["CoreLibraryItemGateway"]=> string(46) "Core\Factory\Gateway\LibraryItemGatewayFactory" ["Core\Model\Services\LibraryItemTypeManager"]=> string(50) "Core\Factory\Manager\LibraryItemTypeManagerFactory" ["Core\Model\Dao\LibraryItemTypeDao"]=> string(42) "Core\Factory\Dao\LibraryItemTypeDaoFactory" ["CoreLibraryItemTypeGateway"]=> string(50) "Core\Factory\Gateway\LibraryItemTypeGatewayFactory" ["Core\Model\Services\MessageManager"]=> string(42) "Core\Factory\Manager\MessageManagerFactory" ["Core\Model\Dao\MessageDao"]=> string(34) "Core\Factory\Dao\MessageDaoFactory" ["CoreMessageGateway"]=> string(42) "Core\Factory\Gateway\MessageGatewayFactory" ["Core\Model\Services\ModuleManager"]=> string(41) "Core\Factory\Manager\ModuleManagerFactory" ["Core\Model\Dao\ModuleDao"]=> string(33) "Core\Factory\Dao\ModuleDaoFactory" ["CoreModuleGateway"]=> string(41) "Core\Factory\Gateway\ModuleGatewayFactory" ["Core\Model\Services\ModuleParameterManager"]=> string(50) "Core\Factory\Manager\ModuleParameterManagerFactory" ["Core\Model\Dao\ModuleParameterDao"]=> string(42) "Core\Factory\Dao\ModuleParameterDaoFactory" ["CoreModuleParameterGateway"]=> string(50) "Core\Factory\Gateway\ModuleParameterGatewayFactory" ["Core\Model\Services\PageManager"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDao"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["CorePageGateway"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\PersonManager"]=> string(41) "Core\Factory\Manager\PersonManagerFactory" ["Core\Model\Dao\PersonDao"]=> string(33) "Core\Factory\Dao\PersonDaoFactory" ["CorePersonGateway"]=> string(41) "Core\Factory\Gateway\PersonGatewayFactory" ["Core\Model\Services\PersonRelationManager"]=> string(49) "Core\Factory\Manager\PersonRelationManagerFactory" ["Core\Model\Dao\PersonRelationDao"]=> string(41) "Core\Factory\Dao\PersonRelationDaoFactory" ["CorePersonRelationGateway"]=> string(49) "Core\Factory\Gateway\PersonRelationGatewayFactory" ["Core\Model\Services\PhoneManager"]=> string(40) "Core\Factory\Manager\PhoneManagerFactory" ["Core\Model\Dao\PhoneDao"]=> string(32) "Core\Factory\Dao\PhoneDaoFactory" ["CorePhoneGateway"]=> string(40) "Core\Factory\Gateway\PhoneGatewayFactory" ["Core\Model\Services\PhoneTypeManager"]=> string(44) "Core\Factory\Manager\PhoneTypeManagerFactory" ["Core\Model\Dao\PhoneTypeDao"]=> string(36) "Core\Factory\Dao\PhoneTypeDaoFactory" ["CorePhoneTypeGateway"]=> string(44) "Core\Factory\Gateway\PhoneTypeGatewayFactory" ["Core\Model\Services\RightManager"]=> string(40) "Core\Factory\Manager\RightManagerFactory" ["Core\Model\Dao\RightDao"]=> string(32) "Core\Factory\Dao\RightDaoFactory" ["CoreRightGateway"]=> string(40) "Core\Factory\Gateway\RightGatewayFactory" ["Core\Model\Services\RoleManager"]=> string(39) "Core\Factory\Manager\RoleManagerFactory" ["Core\Model\Dao\RoleDao"]=> string(31) "Core\Factory\Dao\RoleDaoFactory" ["CoreRoleGateway"]=> string(39) "Core\Factory\Gateway\RoleGatewayFactory" ["Core\Model\Services\RoleTypeManager"]=> string(43) "Core\Factory\Manager\RoleTypeManagerFactory" ["Core\Model\Dao\RoleTypeDao"]=> string(35) "Core\Factory\Dao\RoleTypeDaoFactory" ["CoreRoleTypeGateway"]=> string(43) "Core\Factory\Gateway\RoleTypeGatewayFactory" ["Core\Model\Services\RouteManager"]=> string(40) "Core\Factory\Manager\RouteManagerFactory" ["Core\Model\Dao\RouteDao"]=> string(32) "Core\Factory\Dao\RouteDaoFactory" ["CoreRouteGateway"]=> string(40) "Core\Factory\Gateway\RouteGatewayFactory" ["Core\Model\Services\ShortUrlManager"]=> string(43) "Core\Factory\Manager\ShortUrlManagerFactory" ["Core\Model\Dao\ShortUrlDao"]=> string(35) "Core\Factory\Dao\ShortUrlDaoFactory" ["CoreShortUrlGateway"]=> string(43) "Core\Factory\Gateway\ShortUrlGatewayFactory" ["Core\Model\Services\SiteManager"]=> string(39) "Core\Factory\Manager\SiteManagerFactory" ["Core\Model\Dao\SiteDao"]=> string(31) "Core\Factory\Dao\SiteDaoFactory" ["CoreSiteGateway"]=> string(39) "Core\Factory\Gateway\SiteGatewayFactory" ["Core\Model\Services\SiteDomainManager"]=> string(45) "Core\Factory\Manager\SiteDomainManagerFactory" ["Core\Model\Dao\SiteDomainDao"]=> string(37) "Core\Factory\Dao\SiteDomainDaoFactory" ["CoreSiteDomainGateway"]=> string(45) "Core\Factory\Gateway\SiteDomainGatewayFactory" ["Core\Model\Services\StateManager"]=> string(40) "Core\Factory\Manager\StateManagerFactory" ["Core\Model\Dao\StateDao"]=> string(32) "Core\Factory\Dao\StateDaoFactory" ["CoreStateGateway"]=> string(40) "Core\Factory\Gateway\StateGatewayFactory" ["Core\Model\Services\TemplateManager"]=> string(43) "Core\Factory\Manager\TemplateManagerFactory" ["Core\Model\Dao\TemplateDao"]=> string(35) "Core\Factory\Dao\TemplateDaoFactory" ["CoreTemplateGateway"]=> string(43) "Core\Factory\Gateway\TemplateGatewayFactory" ["Core\Model\Services\TemplateGroupManager"]=> string(48) "Core\Factory\Manager\TemplateGroupManagerFactory" ["Core\Model\Dao\TemplateGroupDao"]=> string(40) "Core\Factory\Dao\TemplateGroupDaoFactory" ["CoreTemplateGroupGateway"]=> string(48) "Core\Factory\Gateway\TemplateGroupGatewayFactory" ["Core\Model\Services\UserManager"]=> string(39) "Core\Factory\Manager\UserManagerFactory" ["Core\Model\Dao\UserDao"]=> string(31) "Core\Factory\Dao\UserDaoFactory" ["CoreUserGateway"]=> string(39) "Core\Factory\Gateway\UserGatewayFactory" ["Core\Model\Services\UserRoleManager"]=> string(43) "Core\Factory\Manager\UserRoleManagerFactory" ["Core\Model\Dao\UserRoleDao"]=> string(35) "Core\Factory\Dao\UserRoleDaoFactory" ["CoreUserRoleGateway"]=> string(43) "Core\Factory\Gateway\UserRoleGatewayFactory" ["Core\Model\Services\UserFavoritObjectManager"]=> string(52) "Core\Factory\Manager\UserFavoritObjectManagerFactory" ["Core\Model\Dao\UserFavoritObjectDao"]=> string(44) "Core\Factory\Dao\UserFavoritObjectDaoFactory" ["CoreUserFavoritObjectGateway"]=> string(52) "Core\Factory\Gateway\UserFavoritObjectGatewayFactory" ["Core\Model\Services\UserSessionManager"]=> string(46) "Core\Factory\Manager\UserSessionManagerFactory" ["Core\Model\Dao\UserSessionDao"]=> string(38) "Core\Factory\Dao\UserSessionDaoFactory" ["CoreUserSessionGateway"]=> string(46) "Core\Factory\Gateway\UserSessionGatewayFactory" ["Core\Model\Services\WebsiteManager"]=> string(42) "Core\Factory\Manager\WebsiteManagerFactory" ["Core\Model\Dao\WebsiteDao"]=> string(34) "Core\Factory\Dao\WebsiteDaoFactory" ["CoreWebsiteGateway"]=> string(42) "Core\Factory\Gateway\WebsiteGatewayFactory" ["Core\Model\Services\WebsiteTypeManager"]=> string(46) "Core\Factory\Manager\WebsiteTypeManagerFactory" ["Core\Model\Dao\WebsiteTypeDao"]=> string(38) "Core\Factory\Dao\WebsiteTypeDaoFactory" ["CoreWebsiteTypeGateway"]=> string(46) "Core\Factory\Gateway\WebsiteTypeGatewayFactory" ["CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyManager"]=> string(45) "Company\Factory\Manager\CompanyManagerFactory" ["Company\Model\Dao\CompanyDao"]=> string(37) "Company\Factory\Dao\CompanyDaoFactory" ["CompanyCompanyGateway"]=> string(45) "Company\Factory\Gateway\CompanyGatewayFactory" ["Company\Model\Services\DomainManager"]=> string(44) "Company\Factory\Manager\DomainManagerFactory" ["Company\Model\Dao\DomainDao"]=> string(36) "Company\Factory\Dao\DomainDaoFactory" ["CompanyDomainGateway"]=> string(44) "Company\Factory\Gateway\DomainGatewayFactory" ["Company\Model\Services\CompanyFunctionManager"]=> string(53) "Company\Factory\Manager\CompanyFunctionManagerFactory" ["Company\Model\Dao\CompanyFunctionDao"]=> string(45) "Company\Factory\Dao\CompanyFunctionDaoFactory" ["CompanyCompanyFunctionGateway"]=> string(53) "Company\Factory\Gateway\CompanyFunctionGatewayFactory" ["Company\Model\Services\EmployeeManager"]=> string(46) "Company\Factory\Manager\EmployeeManagerFactory" ["Company\Model\Dao\EmployeeDao"]=> string(38) "Company\Factory\Dao\EmployeeDaoFactory" ["CompanyEmployeeGateway"]=> string(46) "Company\Factory\Gateway\EmployeeGatewayFactory" ["Company\Model\Services\ContractManager"]=> string(46) "Company\Factory\Manager\ContractManagerFactory" ["Company\Model\Dao\ContractDao"]=> string(38) "Company\Factory\Dao\ContractDaoFactory" ["CompanyContractGateway"]=> string(46) "Company\Factory\Gateway\ContractGatewayFactory" ["Company\Model\Services\ContractTypeManager"]=> string(50) "Company\Factory\Manager\ContractTypeManagerFactory" ["Company\Model\Dao\ContractTypeDao"]=> string(42) "Company\Factory\Dao\ContractTypeDaoFactory" ["CompanyContractTypeGateway"]=> string(50) "Company\Factory\Gateway\ContractTypeGatewayFactory" ["StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["StructuredData\Model\Services\StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactManager"]=> string(45) "Contact\Factory\Manager\ContactManagerFactory" ["Contact\Model\Dao\ContactDao"]=> string(37) "Contact\Factory\Dao\ContactDaoFactory" ["ContactContactGateway"]=> string(45) "Contact\Factory\Gateway\ContactGatewayFactory" ["Contact\Model\Services\ContactAnswerManager"]=> string(51) "Contact\Factory\Manager\ContactAnswerManagerFactory" ["Contact\Model\Dao\ContactAnswerDao"]=> string(43) "Contact\Factory\Dao\ContactAnswerDaoFactory" ["ContactContactAnswerGateway"]=> string(51) "Contact\Factory\Gateway\ContactAnswerGatewayFactory" ["Contact\Model\Services\ContactCommentManager"]=> string(52) "Contact\Factory\Manager\ContactCommentManagerFactory" ["Contact\Model\Dao\ContactCommentDao"]=> string(44) "Contact\Factory\Dao\ContactCommentDaoFactory" ["ContactContactCommentGateway"]=> string(52) "Contact\Factory\Gateway\ContactCommentGatewayFactory" ["Contact\Model\Services\ContactStatusManager"]=> string(51) "Contact\Factory\Manager\ContactStatusManagerFactory" ["Contact\Model\Dao\ContactStatusDao"]=> string(43) "Contact\Factory\Dao\ContactStatusDaoFactory" ["ContactContactStatusGateway"]=> string(51) "Contact\Factory\Gateway\ContactStatusGatewayFactory" ["GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleryManager"]=> string(47) "Galleries\Factory\Manager\GalleryManagerFactory" ["Galleries\Model\Dao\GalleryDao"]=> string(39) "Galleries\Factory\Dao\GalleryDaoFactory" ["GalleriesGalleryGateway"]=> string(47) "Galleries\Factory\Gateway\GalleryGatewayFactory" ["Galleries\Model\Services\ItemManager"]=> string(44) "Galleries\Factory\Manager\ItemManagerFactory" ["Galleries\Model\Dao\ItemDao"]=> string(36) "Galleries\Factory\Dao\ItemDaoFactory" ["GalleriesItemGateway"]=> string(44) "Galleries\Factory\Gateway\ItemGatewayFactory" ["Galleries\Model\Services\ItemTypeManager"]=> string(48) "Galleries\Factory\Manager\ItemTypeManagerFactory" ["Galleries\Model\Dao\ItemTypeDao"]=> string(40) "Galleries\Factory\Dao\ItemTypeDaoFactory" ["GalleriesItemTypeGateway"]=> string(48) "Galleries\Factory\Gateway\ItemTypeGatewayFactory" ["Galleries\Model\Services\ItemCommentManager"]=> string(51) "Galleries\Factory\Manager\ItemCommentManagerFactory" ["Galleries\Model\Dao\ItemCommentDao"]=> string(43) "Galleries\Factory\Dao\ItemCommentDaoFactory" ["GalleriesItemCommentGateway"]=> string(51) "Galleries\Factory\Gateway\ItemCommentGatewayFactory" ["LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogManager"]=> string(38) "Logs\Factory\Manager\LogManagerFactory" ["Logs\Model\Dao\LogDao"]=> string(30) "Logs\Factory\Dao\LogDaoFactory" ["LogsLogGateway"]=> string(38) "Logs\Factory\Gateway\LogGatewayFactory" ["MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuManager"]=> string(39) "Menu\Factory\Manager\MenuManagerFactory" ["Menu\Model\Dao\MenuDao"]=> string(31) "Menu\Factory\Dao\MenuDaoFactory" ["MenuMenuGateway"]=> string(39) "Menu\Factory\Gateway\MenuGatewayFactory" ["Menu\Model\Services\MenuItemManager"]=> string(43) "Menu\Factory\Manager\MenuItemManagerFactory" ["Menu\Model\Dao\MenuItemDao"]=> string(35) "Menu\Factory\Dao\MenuItemDaoFactory" ["MenuMenuItemGateway"]=> string(43) "Menu\Factory\Gateway\MenuItemGatewayFactory" ["WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetManager"]=> string(43) "Widget\Factory\Manager\WidgetManagerFactory" ["Widget\Model\Dao\WidgetDao"]=> string(35) "Widget\Factory\Dao\WidgetDaoFactory" ["WidgetWidgetGateway"]=> string(43) "Widget\Factory\Gateway\WidgetGatewayFactory" ["Widget\Model\Services\WidgetPositionManager"]=> string(51) "Widget\Factory\Manager\WidgetPositionManagerFactory" ["Widget\Model\Dao\WidgetPositionDao"]=> string(43) "Widget\Factory\Dao\WidgetPositionDaoFactory" ["WidgetWidgetPositionGateway"]=> string(51) "Widget\Factory\Gateway\WidgetPositionGatewayFactory" ["ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductManager"]=> string(46) "Products\Factory\Manager\ProductManagerFactory" ["Products\Model\Dao\ProductDao"]=> string(38) "Products\Factory\Dao\ProductDaoFactory" ["ProductsProductGateway"]=> string(46) "Products\Factory\Gateway\ProductGatewayFactory" ["Products\Model\Services\CategoryManager"]=> string(47) "Products\Factory\Manager\CategoryManagerFactory" ["Products\Model\Dao\CategoryDao"]=> string(39) "Products\Factory\Dao\CategoryDaoFactory" ["ProductsCategoryGateway"]=> string(47) "Products\Factory\Gateway\CategoryGatewayFactory" ["Products\Model\Services\ProductTypeManager"]=> string(50) "Products\Factory\Manager\ProductTypeManagerFactory" ["Products\Model\Dao\ProductTypeDao"]=> string(42) "Products\Factory\Dao\ProductTypeDaoFactory" ["ProductsProductTypeGateway"]=> string(50) "Products\Factory\Gateway\ProductTypeGatewayFactory" ["Products\Model\Services\BrandManager"]=> string(44) "Products\Factory\Manager\BrandManagerFactory" ["Products\Model\Dao\BrandDao"]=> string(36) "Products\Factory\Dao\BrandDaoFactory" ["ProductsBrandGateway"]=> string(44) "Products\Factory\Gateway\BrandGatewayFactory" ["Products\Model\Services\CriteriaManager"]=> string(47) "Products\Factory\Manager\CriteriaManagerFactory" ["Products\Model\Dao\CriteriaDao"]=> string(39) "Products\Factory\Dao\CriteriaDaoFactory" ["ProductsCriteriaGateway"]=> string(47) "Products\Factory\Gateway\CriteriaGatewayFactory" ["ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopManager"]=> string(39) "Shop\Factory\Manager\ShopManagerFactory" ["Shop\Model\Dao\ShopDao"]=> string(31) "Shop\Factory\Dao\ShopDaoFactory" ["ShopShopGateway"]=> string(39) "Shop\Factory\Gateway\ShopGatewayFactory" ["Shop\Model\Services\ShopProductManager"]=> string(63) "Caveschateauauvernier\Factory\Manager\ShopProductManagerFactory" ["Shop\Model\Dao\ShopProductDao"]=> string(38) "Shop\Factory\Dao\ShopProductDaoFactory" ["ShopShopProductGateway"]=> string(46) "Shop\Factory\Gateway\ShopProductGatewayFactory" ["Shop\Model\Services\CategoryManager"]=> string(43) "Shop\Factory\Manager\CategoryManagerFactory" ["Shop\Model\Dao\CategoryDao"]=> string(35) "Shop\Factory\Dao\CategoryDaoFactory" ["ShopCategoryGateway"]=> string(43) "Shop\Factory\Gateway\CategoryGatewayFactory" ["Shop\Model\Services\OrderManager"]=> string(40) "Shop\Factory\Manager\OrderManagerFactory" ["Shop\Model\Dao\OrderDao"]=> string(32) "Shop\Factory\Dao\OrderDaoFactory" ["ShopOrderGateway"]=> string(40) "Shop\Factory\Gateway\OrderGatewayFactory" ["Shop\Model\Services\OrderItemManager"]=> string(44) "Shop\Factory\Manager\OrderItemManagerFactory" ["Shop\Model\Dao\OrderItemDao"]=> string(36) "Shop\Factory\Dao\OrderItemDaoFactory" ["ShopOrderItemGateway"]=> string(44) "Shop\Factory\Gateway\OrderItemGatewayFactory" ["Shop\Model\Services\TaxManager"]=> string(38) "Shop\Factory\Manager\TaxManagerFactory" ["Shop\Model\Dao\TaxDao"]=> string(30) "Shop\Factory\Dao\TaxDaoFactory" ["ShopTaxGateway"]=> string(38) "Shop\Factory\Gateway\TaxGatewayFactory" ["Shop\Model\Services\TaxGroupManager"]=> string(43) "Shop\Factory\Manager\TaxGroupManagerFactory" ["Shop\Model\Dao\TaxGroupDao"]=> string(35) "Shop\Factory\Dao\TaxGroupDaoFactory" ["ShopTaxGroupGateway"]=> string(43) "Shop\Factory\Gateway\TaxGroupGatewayFactory" ["Shop\Model\Services\TaxRuleManager"]=> string(42) "Shop\Factory\Manager\TaxRuleManagerFactory" ["Shop\Model\Dao\TaxRuleDao"]=> string(34) "Shop\Factory\Dao\TaxRuleDaoFactory" ["ShopTaxRuleGateway"]=> string(42) "Shop\Factory\Gateway\TaxRuleGatewayFactory" ["Shop\Model\Services\PriceTableManager"]=> string(45) "Shop\Factory\Manager\PriceTableManagerFactory" ["Shop\Model\Dao\PriceTableDao"]=> string(37) "Shop\Factory\Dao\PriceTableDaoFactory" ["ShopPriceTableGateway"]=> string(45) "Shop\Factory\Gateway\PriceTableGatewayFactory" ["Shop\Model\Services\PriceTableConditionnementManager"]=> string(60) "Shop\Factory\Manager\PriceTableConditionnementManagerFactory" ["Shop\Model\Dao\PriceTableConditionnementDao"]=> string(52) "Shop\Factory\Dao\PriceTableConditionnementDaoFactory" ["ShopPriceTableConditionnementGateway"]=> string(60) "Shop\Factory\Gateway\PriceTableConditionnementGatewayFactory" ["Shop\Model\Services\WishListManager"]=> string(43) "Shop\Factory\Manager\WishListManagerFactory" ["Shop\Model\Dao\WishListDao"]=> string(35) "Shop\Factory\Dao\WishListDaoFactory" ["ShopWishListGateway"]=> string(43) "Shop\Factory\Gateway\WishListGatewayFactory" ["Shop\Model\Services\PromotionManager"]=> string(44) "Shop\Factory\Manager\PromotionManagerFactory" ["Shop\Model\Dao\PromotionDao"]=> string(36) "Shop\Factory\Dao\PromotionDaoFactory" ["ShopPromotionGateway"]=> string(44) "Shop\Factory\Gateway\PromotionGatewayFactory" ["Shop\Model\Services\PromotionItemManager"]=> string(48) "Shop\Factory\Manager\PromotionItemManagerFactory" ["Shop\Model\Dao\PromotionItemDao"]=> string(40) "Shop\Factory\Dao\PromotionItemDaoFactory" ["ShopPromotionItemGateway"]=> string(48) "Shop\Factory\Gateway\PromotionItemGatewayFactory" ["Shop\Model\Services\CartManager"]=> string(39) "Shop\Factory\Manager\CartManagerFactory" ["Shop\Model\Dao\CartDao"]=> string(31) "Shop\Factory\Dao\CartDaoFactory" ["ShopCartGateway"]=> string(39) "Shop\Factory\Gateway\CartGatewayFactory" ["Shop\Model\Services\CartItemManager"]=> string(43) "Shop\Factory\Manager\CartItemManagerFactory" ["Shop\Model\Dao\CartItemDao"]=> string(35) "Shop\Factory\Dao\CartItemDaoFactory" ["ShopCartItemGateway"]=> string(43) "Shop\Factory\Gateway\CartItemGatewayFactory" ["Shop\Model\Services\CartConstraintManager"]=> string(49) "Shop\Factory\Manager\CartConstraintManagerFactory" ["Shop\Model\Dao\CartConstraintDao"]=> string(41) "Shop\Factory\Dao\CartConstraintDaoFactory" ["ShopCartConstraintGateway"]=> string(49) "Shop\Factory\Gateway\CartConstraintGatewayFactory" ["Shop\Model\Services\CartRuleManager"]=> string(43) "Shop\Factory\Manager\CartRuleManagerFactory" ["Shop\Model\Dao\CartRuleDao"]=> string(35) "Shop\Factory\Dao\CartRuleDaoFactory" ["ShopCartRuleGateway"]=> string(43) "Shop\Factory\Gateway\CartRuleGatewayFactory" ["Shop\Model\Services\CartRuleRestrictionManager"]=> string(54) "Shop\Factory\Manager\CartRuleRestrictionManagerFactory" ["Shop\Model\Dao\CartRuleRestrictionDao"]=> string(46) "Shop\Factory\Dao\CartRuleRestrictionDaoFactory" ["ShopCartRuleRestrictionGateway"]=> string(54) "Shop\Factory\Gateway\CartRuleRestrictionGatewayFactory" ["Shop\Model\Services\OrderCartRuleManager"]=> string(48) "Shop\Factory\Manager\OrderCartRuleManagerFactory" ["Shop\Model\Dao\OrderCartRuleDao"]=> string(40) "Shop\Factory\Dao\OrderCartRuleDaoFactory" ["ShopOrderCartRuleGateway"]=> string(48) "Shop\Factory\Gateway\OrderCartRuleGatewayFactory" ["Shop\Model\Services\OrderCartRuleRestrictionManager"]=> string(59) "Shop\Factory\Manager\OrderCartRuleRestrictionManagerFactory" ["Shop\Model\Dao\OrderCartRuleRestrictionDao"]=> string(51) "Shop\Factory\Dao\OrderCartRuleRestrictionDaoFactory" ["ShopOrderCartRuleRestrictionGateway"]=> string(59) "Shop\Factory\Gateway\OrderCartRuleRestrictionGatewayFactory" ["PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentManager"]=> string(46) "Payments\Factory\Manager\PaymentManagerFactory" ["Payments\Model\Dao\PaymentDao"]=> string(38) "Payments\Factory\Dao\PaymentDaoFactory" ["PaymentsPaymentGateway"]=> string(46) "Payments\Factory\Gateway\PaymentGatewayFactory" ["Payments\Model\Services\PaymentTypeManager"]=> string(50) "Payments\Factory\Manager\PaymentTypeManagerFactory" ["Payments\Model\Dao\PaymentTypeDao"]=> string(42) "Payments\Factory\Dao\PaymentTypeDaoFactory" ["PaymentsPaymentTypeGateway"]=> string(50) "Payments\Factory\Gateway\PaymentTypeGatewayFactory" ["TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialManager"]=> string(54) "Testimonials\Factory\Manager\TestimonialManagerFactory" ["Testimonials\Model\Dao\TestimonialDao"]=> string(46) "Testimonials\Factory\Dao\TestimonialDaoFactory" ["TestimonialsTestimonialGateway"]=> string(54) "Testimonials\Factory\Gateway\TestimonialGatewayFactory" ["ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopAnalytics\Model\Services\ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["ShopStructuredData\Model\Services\ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\PaymentManager"]=> string(46) "Checkout\Factory\Manager\PaymentManagerFactory" ["Checkout\Model\Services\API\WebHookUrlManager"]=> string(53) "Checkout\Factory\Manager\API\WebHookUrlManagerFactory" ["RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["Recaptcha\Model\Services\RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Caveschateauauvernier\Model\Services\CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Sentry\ClientInterface"]=> string(36) "SentryIO\Service\ClientConfigFactory" ["Sentry\State\HubInterface"]=> string(27) "SentryIO\Service\HubFactory" ["SentryIO\Listener\ErrorHandlerListener"]=> string(45) "SentryIO\Listener\ErrorHandlerListenerFactory" ["Laminas\Db\Adapter\Adapter"]=> string(40) "Laminas\Db\Adapter\AdapterServiceFactory" } ["delegators"]=> array(4) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> array(2) { [0]=> string(77) "Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory" [1]=> string(76) "Laminas\Cache\Storage\Adapter\BlackHole\AdapterPluginManagerDelegatorFactory" } ["HttpRouter"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["Laminas\Router\Http\TreeRouteStack"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["ViewHelperManager"]=> array(1) { [0]=> string(57) "Laminas\Navigation\View\ViewHelperManagerDelegatorFactory" } } ["aliases"]=> array(244) { ["Zend\Di\InjectorInterface"]=> string(28) "Laminas\Di\InjectorInterface" ["Zend\Di\ConfigInterface"]=> string(26) "Laminas\Di\ConfigInterface" ["Zend\Di\CodeGenerator\InjectorGenerator"]=> string(42) "Laminas\Di\CodeGenerator\InjectorGenerator" ["MvcTranslator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["Zend\Mvc\I18n\Translator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["InputFilterManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["Zend\InputFilter\InputFilterPluginManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["HttpRouter"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["router"]=> string(34) "Laminas\Router\RouteStackInterface" ["Router"]=> string(34) "Laminas\Router\RouteStackInterface" ["RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\Http\TreeRouteStack"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["Zend\Router\RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\RouteStackInterface"]=> string(34) "Laminas\Router\RouteStackInterface" ["Laminas\Form\Annotation\AnnotationBuilder"]=> string(21) "FormAnnotationBuilder" ["Laminas\Form\Annotation\AttributeBuilder"]=> string(20) "FormAttributeBuilder" ["Laminas\Form\FormElementManager"]=> string(18) "FormElementManager" ["ValidatorManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Validator\ValidatorPluginManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Mail\Protocol\SmtpPluginManager"]=> string(39) "Laminas\Mail\Protocol\SmtpPluginManager" ["TranslatorPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["Zend\I18n\Translator\TranslatorInterface"]=> string(43) "Laminas\I18n\Translator\TranslatorInterface" ["Zend\I18n\Translator\LoaderPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Zend\Navigation\Navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Core\Interfaces\AddressManagerInterface"]=> string(34) "Core\Model\Services\AddressManager" ["Core\Interfaces\AddressDaoInterface"]=> string(25) "Core\Model\Dao\AddressDao" ["Core\Interfaces\AddressTypeManagerInterface"]=> string(38) "Core\Model\Services\AddressTypeManager" ["Core\Interfaces\AddressTypeDaoInterface"]=> string(29) "Core\Model\Dao\AddressTypeDao" ["Core\Interfaces\AjaxRightManagerInterface"]=> string(36) "Core\Model\Services\AjaxRightManager" ["Core\Interfaces\AjaxRightDaoInterface"]=> string(27) "Core\Model\Dao\AjaxRightDao" ["Core\Interfaces\BankManagerInterface"]=> string(31) "Core\Model\Services\BankManager" ["Core\Interfaces\BankDaoInterface"]=> string(22) "Core\Model\Dao\BankDao" ["Core\Interfaces\BankAccountManagerInterface"]=> string(38) "Core\Model\Services\BankAccountManager" ["Core\Interfaces\BankAccountDaoInterface"]=> string(29) "Core\Model\Dao\BankAccountDao" ["Core\Interfaces\BankAddressManagerInterface"]=> string(38) "Core\Model\Services\BankAddressManager" ["Core\Interfaces\BankAddressDaoInterface"]=> string(29) "Core\Model\Dao\BankAddressDao" ["Core\Interfaces\CertificateManagerInterface"]=> string(38) "Core\Model\Services\CertificateManager" ["Core\Interfaces\CertificateDaoInterface"]=> string(29) "Core\Model\Dao\CertificateDao" ["Core\Interfaces\ClosedDayManagerInterface"]=> string(36) "Core\Model\Services\ClosedDayManager" ["Core\Interfaces\ClosedDayDaoInterface"]=> string(27) "Core\Model\Dao\ClosedDayDao" ["Core\Interfaces\ClosedDayTypeManagerInterface"]=> string(40) "Core\Model\Services\ClosedDayTypeManager" ["Core\Interfaces\ClosedDayTypeDaoInterface"]=> string(31) "Core\Model\Dao\ClosedDayTypeDao" ["Core\Interfaces\CmsListManagerInterface"]=> string(34) "Core\Model\Services\CmsListManager" ["Core\Interfaces\CmsListDaoInterface"]=> string(25) "Core\Model\Dao\CmsListDao" ["Core\Interfaces\CmsListItemManagerInterface"]=> string(38) "Core\Model\Services\CmsListItemManager" ["Core\Interfaces\CmsListItemDaoInterface"]=> string(29) "Core\Model\Dao\CmsListItemDao" ["Core\Interfaces\ContentManagerInterface"]=> string(34) "Core\Model\Services\ContentManager" ["Core\Interfaces\ContentDaoInterface"]=> string(25) "Core\Model\Dao\ContentDao" ["Core\Interfaces\CmsObjectManagerInterface"]=> string(36) "Core\Model\Services\CmsObjectManager" ["Core\Interfaces\CmsObjectDaoInterface"]=> string(27) "Core\Model\Dao\CmsObjectDao" ["Core\Interfaces\CmsObjectTypeManagerInterface"]=> string(40) "Core\Model\Services\CmsObjectTypeManager" ["Core\Interfaces\CmsObjectTypeDaoInterface"]=> string(31) "Core\Model\Dao\CmsObjectTypeDao" ["Core\Interfaces\CmsObjectPropertyManagerInterface"]=> string(44) "Core\Model\Services\CmsObjectPropertyManager" ["Core\Interfaces\CmsObjectPropertyDaoInterface"]=> string(35) "Core\Model\Dao\CmsObjectPropertyDao" ["Core\Interfaces\CmsObjectPropertyTypeManagerInterface"]=> string(48) "Core\Model\Services\CmsObjectPropertyTypeManager" ["Core\Interfaces\CmsObjectPropertyTypeDaoInterface"]=> string(39) "Core\Model\Dao\CmsObjectPropertyTypeDao" ["Core\Interfaces\CmsUserManagerInterface"]=> string(34) "Core\Model\Services\CmsUserManager" ["Core\Interfaces\CmsUserDaoInterface"]=> string(25) "Core\Model\Dao\CmsUserDao" ["Core\Interfaces\ControllerActionManagerInterface"]=> string(43) "Core\Model\Services\ControllerActionManager" ["Core\Interfaces\ControllerActionDaoInterface"]=> string(34) "Core\Model\Dao\ControllerActionDao" ["Core\Interfaces\ControllerActionTemplateManagerInterface"]=> string(51) "Core\Model\Services\ControllerActionTemplateManager" ["Core\Interfaces\ControllerActionTemplateDaoInterface"]=> string(42) "Core\Model\Dao\ControllerActionTemplateDao" ["Core\Interfaces\CurrencyManagerInterface"]=> string(35) "Core\Model\Services\CurrencyManager" ["Core\Interfaces\CurrencyDaoInterface"]=> string(26) "Core\Model\Dao\CurrencyDao" ["Core\Interfaces\CityManagerInterface"]=> string(31) "Core\Model\Services\CityManager" ["Core\Interfaces\CityDaoInterface"]=> string(22) "Core\Model\Dao\CityDao" ["Core\Interfaces\ContinentManagerInterface"]=> string(36) "Core\Model\Services\ContinentManager" ["Core\Interfaces\ContinentDaoInterface"]=> string(27) "Core\Model\Dao\ContinentDao" ["Core\Interfaces\CountryManagerInterface"]=> string(34) "Core\Model\Services\CountryManager" ["Core\Interfaces\CountryDaoInterface"]=> string(25) "Core\Model\Dao\CountryDao" ["Core\Interfaces\DebugIpManagerInterface"]=> string(34) "Core\Model\Services\DebugIpManager" ["Core\Interfaces\DebugIpDaoInterface"]=> string(25) "Core\Model\Dao\DebugIpDao" ["Core\Interfaces\DeliveryTypeManagerInterface"]=> string(39) "Core\Model\Services\DeliveryTypeManager" ["Core\Interfaces\DeliveryTypeDaoInterface"]=> string(30) "Core\Model\Dao\DeliveryTypeDao" ["Core\Interfaces\EmailManagerInterface"]=> string(32) "Core\Model\Services\EmailManager" ["Core\Interfaces\EmailDaoInterface"]=> string(23) "Core\Model\Dao\EmailDao" ["Core\Interfaces\EmailMessageManagerInterface"]=> string(39) "Core\Model\Services\EmailMessageManager" ["Core\Interfaces\EmailMessageDaoInterface"]=> string(30) "Core\Model\Dao\EmailMessageDao" ["Core\Interfaces\EmailTypeManagerInterface"]=> string(36) "Core\Model\Services\EmailTypeManager" ["Core\Interfaces\EmailTypeDaoInterface"]=> string(27) "Core\Model\Dao\EmailTypeDao" ["Core\Interfaces\EntityRightManagerInterface"]=> string(38) "Core\Model\Services\EntityRightManager" ["Core\Interfaces\EntityRightDaoInterface"]=> string(29) "Core\Model\Dao\EntityRightDao" ["Core\Interfaces\ExtranetUserManagerInterface"]=> string(39) "Core\Model\Services\ExtranetUserManager" ["Core\Interfaces\ExtranetUserDaoInterface"]=> string(30) "Core\Model\Dao\ExtranetUserDao" ["Core\Interfaces\FormManagerInterface"]=> string(31) "Core\Model\Services\FormManager" ["Core\Interfaces\FormDaoInterface"]=> string(22) "Core\Model\Dao\FormDao" ["Core\Interfaces\FormFieldsetManagerInterface"]=> string(39) "Core\Model\Services\FormFieldsetManager" ["Core\Interfaces\FormFieldsetDaoInterface"]=> string(30) "Core\Model\Dao\FormFieldsetDao" ["Core\Interfaces\FormFieldManagerInterface"]=> string(36) "Core\Model\Services\FormFieldManager" ["Core\Interfaces\FormFieldDaoInterface"]=> string(27) "Core\Model\Dao\FormFieldDao" ["Core\Interfaces\LanguageManagerInterface"]=> string(35) "Core\Model\Services\LanguageManager" ["Core\Interfaces\LanguageDaoInterface"]=> string(26) "Core\Model\Dao\LanguageDao" ["Core\Interfaces\LibraryManagerInterface"]=> string(34) "Core\Model\Services\LibraryManager" ["Core\Interfaces\LibraryDaoInterface"]=> string(25) "Core\Model\Dao\LibraryDao" ["Core\Interfaces\LibraryTypeManagerInterface"]=> string(38) "Core\Model\Services\LibraryTypeManager" ["Core\Interfaces\LibraryTypeDaoInterface"]=> string(29) "Core\Model\Dao\LibraryTypeDao" ["Core\Interfaces\LibraryItemManagerInterface"]=> string(38) "Core\Model\Services\LibraryItemManager" ["Core\Interfaces\LibraryItemDaoInterface"]=> string(29) "Core\Model\Dao\LibraryItemDao" ["Core\Interfaces\LibraryItemTypeManagerInterface"]=> string(42) "Core\Model\Services\LibraryItemTypeManager" ["Core\Interfaces\LibraryItemTypeDaoInterface"]=> string(33) "Core\Model\Dao\LibraryItemTypeDao" ["Core\Interfaces\MessageManagerInterface"]=> string(34) "Core\Model\Services\MessageManager" ["Core\Interfaces\MessageDaoInterface"]=> string(25) "Core\Model\Dao\MessageDao" ["Core\Interfaces\ModuleManagerInterface"]=> string(33) "Core\Model\Services\ModuleManager" ["Core\Interfaces\ModuleDaoInterface"]=> string(24) "Core\Model\Dao\ModuleDao" ["Core\Interfaces\ModuleParameterManagerInterface"]=> string(42) "Core\Model\Services\ModuleParameterManager" ["Core\Interfaces\ModuleParameterDaoInterface"]=> string(33) "Core\Model\Dao\ModuleParameterDao" ["Core\Interfaces\PageManagerInterface"]=> string(31) "Core\Model\Services\PageManager" ["Core\Interfaces\PageDaoInterface"]=> string(22) "Core\Model\Dao\PageDao" ["Core\Interfaces\PersonManagerInterface"]=> string(33) "Core\Model\Services\PersonManager" ["Core\Interfaces\PersonDaoInterface"]=> string(24) "Core\Model\Dao\PersonDao" ["Core\Interfaces\PersonRelationManagerInterface"]=> string(41) "Core\Model\Services\PersonRelationManager" ["Core\Interfaces\PersonRelationDaoInterface"]=> string(32) "Core\Model\Dao\PersonRelationDao" ["Core\Interfaces\PhoneManagerInterface"]=> string(32) "Core\Model\Services\PhoneManager" ["Core\Interfaces\PhoneDaoInterface"]=> string(23) "Core\Model\Dao\PhoneDao" ["Core\Interfaces\PhoneTypeManagerInterface"]=> string(36) "Core\Model\Services\PhoneTypeManager" ["Core\Interfaces\PhoneTypeDaoInterface"]=> string(27) "Core\Model\Dao\PhoneTypeDao" ["Core\Interfaces\RightManagerInterface"]=> string(32) "Core\Model\Services\RightManager" ["Core\Interfaces\RightDaoInterface"]=> string(23) "Core\Model\Dao\RightDao" ["Core\Interfaces\RoleManagerInterface"]=> string(31) "Core\Model\Services\RoleManager" ["Core\Interfaces\RoleDaoInterface"]=> string(22) "Core\Model\Dao\RoleDao" ["Core\Interfaces\RoleTypeManagerInterface"]=> string(35) "Core\Model\Services\RoleTypeManager" ["Core\Interfaces\RoleTypeDaoInterface"]=> string(26) "Core\Model\Dao\RoleTypeDao" ["Core\Interfaces\RouteManagerInterface"]=> string(32) "Core\Model\Services\RouteManager" ["Core\Interfaces\RouteDaoInterface"]=> string(23) "Core\Model\Dao\RouteDao" ["Core\Interfaces\ShortUrlManagerInterface"]=> string(35) "Core\Model\Services\ShortUrlManager" ["Core\Interfaces\ShortUrlDaoInterface"]=> string(26) "Core\Model\Dao\ShortUrlDao" ["Core\Interfaces\SiteManagerInterface"]=> string(31) "Core\Model\Services\SiteManager" ["Core\Interfaces\SiteDaoInterface"]=> string(22) "Core\Model\Dao\SiteDao" ["Core\Interfaces\SiteDomainManagerInterface"]=> string(37) "Core\Model\Services\SiteDomainManager" ["Core\Interfaces\SiteDomainDaoInterface"]=> string(28) "Core\Model\Dao\SiteDomainDao" ["Core\Interfaces\StateManagerInterface"]=> string(32) "Core\Model\Services\StateManager" ["Core\Interfaces\StateDaoInterface"]=> string(23) "Core\Model\Dao\StateDao" ["Core\Interfaces\TemplateManagerInterface"]=> string(35) "Core\Model\Services\TemplateManager" ["Core\Interfaces\TemplateDaoInterface"]=> string(26) "Core\Model\Dao\TemplateDao" ["Core\Interfaces\TemplateGroupManagerInterface"]=> string(40) "Core\Model\Services\TemplateGroupManager" ["Core\Interfaces\TemplateGroupDaoInterface"]=> string(31) "Core\Model\Dao\TemplateGroupDao" ["Core\Interfaces\UserManagerInterface"]=> string(31) "Core\Model\Services\UserManager" ["Core\Interfaces\UserDaoInterface"]=> string(22) "Core\Model\Dao\UserDao" ["Core\Interfaces\UserSessionManagerInterface"]=> string(38) "Core\Model\Services\UserSessionManager" ["Core\Interfaces\UserSessionDaoInterface"]=> string(29) "Core\Model\Dao\UserSessionDao" ["Core\Interfaces\UserRoleManagerInterface"]=> string(35) "Core\Model\Services\UserRoleManager" ["Core\Interfaces\UserRoleDaoInterface"]=> string(26) "Core\Model\Dao\UserRoleDao" ["Core\Interfaces\UserFavoritObjectManagerInterface"]=> string(44) "Core\Model\Services\UserFavoritObjectManager" ["Core\Interfaces\UserFavoritObjectDaoInterface"]=> string(35) "Core\Model\Dao\UserFavoritObjectDao" ["Core\Interfaces\WebsiteManagerInterface"]=> string(34) "Core\Model\Services\WebsiteManager" ["Core\Interfaces\WebsiteDaoInterface"]=> string(25) "Core\Model\Dao\WebsiteDao" ["Core\Interfaces\WebsiteTypeManagerInterface"]=> string(38) "Core\Model\Services\WebsiteTypeManager" ["Core\Interfaces\WebsiteTypeDaoInterface"]=> string(29) "Core\Model\Dao\WebsiteTypeDao" ["Company\Interfaces\CompanyManagerInterface"]=> string(37) "Company\Model\Services\CompanyManager" ["Company\Interfaces\CompanyDaoInterface"]=> string(28) "Company\Model\Dao\CompanyDao" ["Company\Interfaces\DomainManagerInterface"]=> string(36) "Company\Model\Services\DomainManager" ["Company\Interfaces\DomainDaoInterface"]=> string(27) "Company\Model\Dao\DomainDao" ["Company\Interfaces\CompanyFunctionManagerInterface"]=> string(45) "Company\Model\Services\CompanyFunctionManager" ["Company\Interfaces\CompanyFunctionDaoInterface"]=> string(36) "Company\Model\Dao\CompanyFunctionDao" ["Company\Interfaces\EmployeeManagerInterface"]=> string(38) "Company\Model\Services\EmployeeManager" ["Company\Interfaces\EmployeeDaoInterface"]=> string(29) "Company\Model\Dao\EmployeeDao" ["Company\Interfaces\ContractManagerInterface"]=> string(38) "Company\Model\Services\ContractManager" ["Company\Interfaces\ContractDaoInterface"]=> string(29) "Company\Model\Dao\ContractDao" ["Company\Interfaces\ContractTypeManagerInterface"]=> string(42) "Company\Model\Services\ContractTypeManager" ["Company\Interfaces\ContractTypeDaoInterface"]=> string(33) "Company\Model\Dao\ContractTypeDao" ["Contact\Interfaces\ContactManagerInterface"]=> string(37) "Contact\Model\Services\ContactManager" ["Contact\Interfaces\ContactDaoInterface"]=> string(28) "Contact\Model\Dao\ContactDao" ["Contact\Interfaces\ContactAnswerManagerInterface"]=> string(43) "Contact\Model\Services\ContactAnswerManager" ["Contact\Interfaces\ContactAnswerDaoInterface"]=> string(34) "Contact\Model\Dao\ContactAnswerDao" ["Contact\Interfaces\ContactCommentManagerInterface"]=> string(44) "Contact\Model\Services\ContactCommentManager" ["Contact\Interfaces\ContactCommentDaoInterface"]=> string(35) "Contact\Model\Dao\ContactCommentDao" ["Contact\Interfaces\ContactStatusManagerInterface"]=> string(43) "Contact\Model\Services\ContactStatusManager" ["Contact\Interfaces\ContactStatusDaoInterface"]=> string(34) "Contact\Model\Dao\ContactStatusDao" ["Galleries\Interfaces\GalleryManagerInterface"]=> string(39) "Galleries\Model\Services\GalleryManager" ["Galleries\Interfaces\GalleryDaoInterface"]=> string(30) "Galleries\Model\Dao\GalleryDao" ["Galleries\Interfaces\ItemManagerInterface"]=> string(36) "Galleries\Model\Services\ItemManager" ["Galleries\Interfaces\ItemDaoInterface"]=> string(27) "Galleries\Model\Dao\ItemDao" ["Galleries\Interfaces\ItemTypeManagerInterface"]=> string(40) "Galleries\Model\Services\ItemTypeManager" ["Galleries\Interfaces\ItemTypeDaoInterface"]=> string(31) "Galleries\Model\Dao\ItemTypeDao" ["Galleries\Interfaces\ItemCommentManagerInterface"]=> string(43) "Galleries\Model\Services\ItemCommentManager" ["Galleries\Interfaces\ItemCommentDaoInterface"]=> string(34) "Galleries\Model\Dao\ItemCommentDao" ["Logs\Interfaces\LogManagerInterface"]=> string(30) "Logs\Model\Services\LogManager" ["Logs\Interfaces\LogDaoInterface"]=> string(21) "Logs\Model\Dao\LogDao" ["Menu\Interfaces\MenuManagerInterface"]=> string(31) "Menu\Model\Services\MenuManager" ["Menu\Interfaces\MenuDaoInterface"]=> string(22) "Menu\Model\Dao\MenuDao" ["Menu\Interfaces\MenuItemManagerInterface"]=> string(35) "Menu\Model\Services\MenuItemManager" ["Menu\Interfaces\MenuItemDaoInterface"]=> string(26) "Menu\Model\Dao\MenuItemDao" ["Widget\Interfaces\WidgetManagerInterface"]=> string(35) "Widget\Model\Services\WidgetManager" ["Widget\Interfaces\WidgetDaoInterface"]=> string(26) "Widget\Model\Dao\WidgetDao" ["Widget\Interfaces\WidgetPositionManagerInterface"]=> string(43) "Widget\Model\Services\WidgetPositionManager" ["Widget\Interfaces\WidgetPositionDaoInterface"]=> string(34) "Widget\Model\Dao\WidgetPositionDao" ["Products\Interfaces\ProductManagerInterface"]=> string(38) "Products\Model\Services\ProductManager" ["Products\Interfaces\ProductDaoInterface"]=> string(29) "Products\Model\Dao\ProductDao" ["Products\Interfaces\CategoryManagerInterface"]=> string(39) "Products\Model\Services\CategoryManager" ["Products\Interfaces\CategoryDaoInterface"]=> string(30) "Products\Model\Dao\CategoryDao" ["Products\Interfaces\ProductTypeManagerInterface"]=> string(42) "Products\Model\Services\ProductTypeManager" ["Products\Interfaces\ProductTypeDaoInterface"]=> string(33) "Products\Model\Dao\ProductTypeDao" ["Products\Interfaces\BrandManagerInterface"]=> string(36) "Products\Model\Services\BrandManager" ["Products\Interfaces\BrandDaoInterface"]=> string(27) "Products\Model\Dao\BrandDao" ["Products\Interfaces\CriteriaManagerInterface"]=> string(39) "Products\Model\Services\CriteriaManager" ["Products\Interfaces\CriteriaDaoInterface"]=> string(30) "Products\Model\Dao\CriteriaDao" ["Shop\Interfaces\ShopManagerInterface"]=> string(31) "Shop\Model\Services\ShopManager" ["Shop\Interfaces\ShopDaoInterface"]=> string(22) "Shop\Model\Dao\ShopDao" ["Shop\Interfaces\ShopProductManagerInterface"]=> string(38) "Shop\Model\Services\ShopProductManager" ["Shop\Interfaces\ShopProductDaoInterface"]=> string(29) "Shop\Model\Dao\ShopProductDao" ["Shop\Interfaces\CategoryManagerInterface"]=> string(35) "Shop\Model\Services\CategoryManager" ["Shop\Interfaces\CategoryDaoInterface"]=> string(26) "Shop\Model\Dao\CategoryDao" ["Shop\Interfaces\OrderManagerInterface"]=> string(32) "Shop\Model\Services\OrderManager" ["Shop\Interfaces\OrderDaoInterface"]=> string(23) "Shop\Model\Dao\OrderDao" ["Shop\Interfaces\OrderItemManagerInterface"]=> string(36) "Shop\Model\Services\OrderItemManager" ["Shop\Interfaces\OrderItemDaoInterface"]=> string(27) "Shop\Model\Dao\OrderItemDao" ["Shop\Interfaces\TaxManagerInterface"]=> string(30) "Shop\Model\Services\TaxManager" ["Shop\Interfaces\TaxDaoInterface"]=> string(21) "Shop\Model\Dao\TaxDao" ["Shop\Interfaces\TaxGroupManagerInterface"]=> string(35) "Shop\Model\Services\TaxGroupManager" ["Shop\Interfaces\TaxGroupDaoInterface"]=> string(26) "Shop\Model\Dao\TaxGroupDao" ["Shop\Interfaces\TaxRuleManagerInterface"]=> string(34) "Shop\Model\Services\TaxRuleManager" ["Shop\Interfaces\TaxRuleDaoInterface"]=> string(25) "Shop\Model\Dao\TaxRuleDao" ["Shop\Interfaces\PriceTableManagerInterface"]=> string(37) "Shop\Model\Services\PriceTableManager" ["Shop\Interfaces\PriceTableDaoInterface"]=> string(28) "Shop\Model\Dao\PriceTableDao" ["Shop\Interfaces\PriceTableConditionnementManagerInterface"]=> string(52) "Shop\Model\Services\PriceTableConditionnementManager" ["Shop\Interfaces\PriceTableConditionnementDaoInterface"]=> string(43) "Shop\Model\Dao\PriceTableConditionnementDao" ["Shop\Interfaces\WishListManagerInterface"]=> string(35) "Shop\Model\Services\WishListManager" ["Shop\Interfaces\WishListDaoInterface"]=> string(26) "Shop\Model\Dao\WishListDao" ["Shop\Interfaces\PromotionManagerInterface"]=> string(36) "Shop\Model\Services\PromotionManager" ["Shop\Interfaces\PromotionDaoInterface"]=> string(27) "Shop\Model\Dao\PromotionDao" ["Shop\Interfaces\PromotionItemManagerInterface"]=> string(40) "Shop\Model\Services\PromotionItemManager" ["Shop\Interfaces\PromotionItemDaoInterface"]=> string(31) "Shop\Model\Dao\PromotionItemDao" ["Shop\Interfaces\CartManagerInterface"]=> string(31) "Shop\Model\Services\CartManager" ["Shop\Interfaces\CartDaoInterface"]=> string(22) "Shop\Model\Dao\CartDao" ["Shop\Interfaces\CartItemManagerInterface"]=> string(35) "Shop\Model\Services\CartItemManager" ["Shop\Interfaces\CartItemDaoInterface"]=> string(26) "Shop\Model\Dao\CartItemDao" ["Shop\Interfaces\CartConstraintManagerInterface"]=> string(41) "Shop\Model\Services\CartConstraintManager" ["Shop\Interfaces\CartConstraintDaoInterface"]=> string(32) "Shop\Model\Dao\CartConstraintDao" ["Shop\Interfaces\CartRuleManagerInterface"]=> string(35) "Shop\Model\Services\CartRuleManager" ["Shop\Interfaces\CartRuleDaoInterface"]=> string(26) "Shop\Model\Dao\CartRuleDao" ["Shop\Interfaces\CartRuleRestrictionManagerInterface"]=> string(46) "Shop\Model\Services\CartRuleRestrictionManager" ["Shop\Interfaces\CartRuleRestrictionDaoInterface"]=> string(37) "Shop\Model\Dao\CartRuleRestrictionDao" ["Shop\Interfaces\OrderCartRuleManagerInterface"]=> string(40) "Shop\Model\Services\OrderCartRuleManager" ["Shop\Interfaces\OrderCartRuleDaoInterface"]=> string(31) "Shop\Model\Dao\OrderCartRuleDao" ["Shop\Interfaces\OrderCartRuleRestrictionManagerInterface"]=> string(51) "Shop\Model\Services\OrderCartRuleRestrictionManager" ["Shop\Interfaces\OrderCartRuleRestrictionDaoInterface"]=> string(42) "Shop\Model\Dao\OrderCartRuleRestrictionDao" ["Payments\Interfaces\PaymentManagerInterface"]=> string(38) "Payments\Model\Services\PaymentManager" ["Payments\Interfaces\PaymentDaoInterface"]=> string(29) "Payments\Model\Dao\PaymentDao" ["Payments\Interfaces\PaymentTypeManagerInterface"]=> string(42) "Payments\Model\Services\PaymentTypeManager" ["Payments\Interfaces\PaymentTypeDaoInterface"]=> string(33) "Payments\Model\Dao\PaymentTypeDao" ["Testimonials\Interfaces\TestimonialManagerInterface"]=> string(46) "Testimonials\Model\Services\TestimonialManager" ["Testimonials\Interfaces\TestimonialDaoInterface"]=> string(37) "Testimonials\Model\Dao\TestimonialDao" ["Checkout\Interfaces\PaymentManagerInterface"]=> string(38) "Checkout\Model\Services\PaymentManager" } } ["laminas-cli"]=> array(0) { } ["controller_plugins"]=> array(2) { ["aliases"]=> array(25) { ["identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Laminas\Mvc\Controller\Plugin\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Zend\Mvc\Controller\Plugin\Identity"]=> string(38) "Laminas\Mvc\Controller\Plugin\Identity" ["Zend\Mvc\Plugin\Identity\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["fileprg"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filepostredirectget"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Laminas\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Zend\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(49) "Laminas\Mvc\Controller\Plugin\FilePostRedirectGet" ["Zend\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["prg"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postredirectget"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Laminas\Mvc\Controller\Plugin\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Zend\Mvc\Controller\Plugin\PostRedirectGet"]=> string(45) "Laminas\Mvc\Controller\Plugin\PostRedirectGet" ["Zend\Mvc\Plugin\Prg\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["flashmessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["flashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Laminas\Mvc\Controller\Plugin\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Zend\Mvc\Controller\Plugin\FlashMessenger"]=> string(44) "Laminas\Mvc\Controller\Plugin\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" } ["factories"]=> array(4) { ["Laminas\Mvc\Plugin\Identity\Identity"]=> string(43) "Laminas\Mvc\Plugin\Identity\IdentityFactory" ["Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\Prg\PostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["input_filters"]=> array(1) { ["abstract_factories"]=> array(1) { [0]=> string(53) "Laminas\InputFilter\InputFilterAbstractServiceFactory" } } ["route_manager"]=> array(0) { } ["router"]=> array(1) { ["routes"]=> array(14) { ["home"]=> array(2) { ["type"]=> string(27) "Laminas\Router\Http\Literal" ["options"]=> array(2) { ["route"]=> string(1) "/" ["defaults"]=> array(2) { ["controller"]=> string(20) "Core\Controller\Core" ["action"]=> string(5) "index" } } } ["core.cron.xmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontasks/xmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(10) "xmlsitemap" } } } ["core.cron.mlxmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(23) "/crontasks/mlxmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(12) "mlxmlsitemap" } } } ["core.form.checkunique"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/check-unique-ajax" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "checkunique" } } } ["core.empty"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontask/executeonce" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "executeonce" } } } ["core.crypt.smtppass"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(25) "/bwt_tools/crypt/smtppass" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(13) "cryptsmtppass" } } } ["core.account.activation.email"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(22) "/user/activation/email" ["defaults"]=> array(2) { ["controller"]=> string(30) "Core\Controller\CoreController" ["action"]=> string(32) "resenduseraccountactivationemail" } } } ["search.cron.indexation"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(27) "/crontasks/searchindexation" ["defaults"]=> array(2) { ["controller"]=> string(28) "Search\Controller\IndexAdmin" ["action"]=> string(12) "rebuildindex" } } } ["search.search"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(12) "/search-ajax" ["defaults"]=> array(2) { ["controller"]=> string(24) "Search\Controller\Search" ["action"]=> string(10) "searchajax" } } } ["shop.order.tocart"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/shop/order/tocart" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(11) "ordertocart" } } } ["shop.order.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.en.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/en/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.fr.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/fr/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["checkout.hook.backurl"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/checkout/bkurl" ["defaults"]=> array(2) { ["controller"]=> string(37) "Checkout\Controller\PaymentController" ["action"]=> string(7) "backurl" } } } } } ["view_helpers"]=> array(2) { ["aliases"]=> array(222) { ["form"]=> string(29) "Laminas\Form\View\Helper\Form" ["Form"]=> string(29) "Laminas\Form\View\Helper\Form" ["formbutton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["form_button"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["FormButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formcaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["form_captcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["formCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["FormCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["captchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha/dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["CaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formcaptchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["form_captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["FormCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha/figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["CaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formcaptchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["form_captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["FormCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha/image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["CaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formcaptchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["form_captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["FormCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha/recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["CaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcaptcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["form_captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["FormCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["form_checkbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["FormCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formcollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["form_collection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["FormCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formcolor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["form_color"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["FormColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formdate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["form_date"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["FormDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formdatetime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["form_date_time"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["FormDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formdatetimelocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["form_date_time_local"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["FormDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formdatetimeselect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["form_date_time_select"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["FormDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formdateselect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_date_select"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["formDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["FormDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_element"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formelement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["FormElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["form_element_errors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formelementerrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["FormElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["form_email"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formemail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["FormEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["form_file"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["FormFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfileapcprogress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["form_file_apc_progress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["FormFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formfilesessionprogress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["form_file_session_progress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["FormFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formfileuploadprogress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["form_file_upload_progress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["FormFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formhidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["form_hidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["FormHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formimage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["form_image"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["formImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["FormImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["forminput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["form_input"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["FormInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formlabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["form_label"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["FormLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formmonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["form_month"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["FormMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formmonthselect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["form_month_select"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["FormMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formmulticheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["form_multi_checkbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["FormMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formnumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["form_number"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["FormNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formpassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["form_password"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["FormPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formradio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["form_radio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["FormRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formrange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["form_range"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["FormRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formreset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["form_reset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["FormReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formrow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["form_row"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["FormRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formsearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["form_search"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["FormSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formselect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["form_select"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["FormSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formsubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["form_submit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["FormSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formtel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["form_tel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["FormTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formtext"]=> string(33) "Laminas\Form\View\Helper\FormText" ["form_text"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["FormText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formtextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["form_text_area"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["FormTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formtime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["form_time"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["FormTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formurl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["form_url"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["FormUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formweek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["form_week"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["formWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["FormWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["flashmessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["flashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["zendviewhelperflashmessenger"]=> string(31) "laminasviewhelperflashmessenger" ["currencyformat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["currencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["dateformat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["dateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["numberformat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["numberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["translateplural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["translatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["Zend\I18n\View\Helper\CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["Zend\I18n\View\Helper\DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["Zend\I18n\View\Helper\NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["Zend\I18n\View\Helper\Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Zend\I18n\View\Helper\Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Zend\I18n\View\Helper\TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" } ["factories"]=> array(52) { ["Laminas\Form\View\Helper\Form"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormButton"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Dumb"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Figlet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Image"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\ReCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCollection"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormColor"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeLocal"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElement"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElementErrors"]=> string(57) "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory" ["Laminas\Form\View\Helper\FormEmail"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormFile"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileApcProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileSessionProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileUploadProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormHidden"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormImage"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormInput"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormLabel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonth"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonthSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMultiCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormPassword"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRadio"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRange"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormReset"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRow"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSearch"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSubmit"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormText"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTextarea"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormUrl"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormWeek"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["laminasviewhelperflashmessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["Laminas\I18n\View\Helper\CurrencyFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\DateFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Plural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Translate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\TranslatePlural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["filters"]=> array(2) { ["aliases"]=> array(14) { ["alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["numberformat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberparse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["numberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["Zend\I18n\Filter\Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Zend\I18n\Filter\Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Zend\I18n\Filter\NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["Zend\I18n\Filter\NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" } ["factories"]=> array(4) { ["Laminas\I18n\Filter\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberParse"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["validators"]=> array(2) { ["aliases"]=> array(30) { ["alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["datetime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["dateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isfloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isint"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["phonenumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["phoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["postcode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["postCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["Zend\I18n\Validator\Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Zend\I18n\Validator\Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Zend\I18n\Validator\DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["Zend\I18n\Validator\IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Zend\I18n\Validator\IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Zend\I18n\Validator\PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["Zend\I18n\Validator\PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" } ["factories"]=> array(7) { ["Laminas\I18n\Validator\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\DateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsFloat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsInt"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PhoneNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PostCode"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["controllers"]=> array(2) { ["factories"]=> array(232) { ["Core\Controller\CoreController"]=> string(45) "Core\Factory\Controller\CoreControllerFactory" ["Core\Controller\AdminController"]=> string(46) "Core\Factory\Controller\AdminControllerFactory" ["Core\Controller\AddressController"]=> string(48) "Core\Factory\Controller\AddressControllerFactory" ["Core\Controller\AddressAdminController"]=> string(53) "Core\Factory\Controller\AddressAdminControllerFactory" ["Core\Controller\AddressTypeController"]=> string(52) "Core\Factory\Controller\AddressTypeControllerFactory" ["Core\Controller\AddressTypeAdminController"]=> string(57) "Core\Factory\Controller\AddressTypeAdminControllerFactory" ["Core\Controller\AjaxRightController"]=> string(50) "Core\Factory\Controller\AjaxRightControllerFactory" ["Core\Controller\AjaxRightAdminController"]=> string(55) "Core\Factory\Controller\AjaxRightAdminControllerFactory" ["Core\Controller\BankController"]=> string(45) "Core\Factory\Controller\BankControllerFactory" ["Core\Controller\BankAdminController"]=> string(50) "Core\Factory\Controller\BankAdminControllerFactory" ["Core\Controller\BankAccountController"]=> string(52) "Core\Factory\Controller\BankAccountControllerFactory" ["Core\Controller\BankAccountAdminController"]=> string(57) "Core\Factory\Controller\BankAccountAdminControllerFactory" ["Core\Controller\BankAddressController"]=> string(52) "Core\Factory\Controller\BankAddressControllerFactory" ["Core\Controller\BankAddressAdminController"]=> string(57) "Core\Factory\Controller\BankAddressAdminControllerFactory" ["Core\Controller\CertificateController"]=> string(52) "Core\Factory\Controller\CertificateControllerFactory" ["Core\Controller\CertificateAdminController"]=> string(57) "Core\Factory\Controller\CertificateAdminControllerFactory" ["Core\Controller\ClosedDayController"]=> string(50) "Core\Factory\Controller\ClosedDayControllerFactory" ["Core\Controller\ClosedDayAdminController"]=> string(55) "Core\Factory\Controller\ClosedDayAdminControllerFactory" ["Core\Controller\ClosedDayTypeController"]=> string(54) "Core\Factory\Controller\ClosedDayTypeControllerFactory" ["Core\Controller\ClosedDayTypeAdminController"]=> string(59) "Core\Factory\Controller\ClosedDayTypeAdminControllerFactory" ["Core\Controller\CmsListController"]=> string(48) "Core\Factory\Controller\CmsListControllerFactory" ["Core\Controller\CmsListAdminController"]=> string(53) "Core\Factory\Controller\CmsListAdminControllerFactory" ["Core\Controller\CmsListItemController"]=> string(52) "Core\Factory\Controller\CmsListItemControllerFactory" ["Core\Controller\CmsListItemAdminController"]=> string(57) "Core\Factory\Controller\CmsListItemAdminControllerFactory" ["Core\Controller\ContentController"]=> string(48) "Core\Factory\Controller\ContentControllerFactory" ["Core\Controller\ContentAdminController"]=> string(53) "Core\Factory\Controller\ContentAdminControllerFactory" ["Core\Controller\CmsObjectController"]=> string(50) "Core\Factory\Controller\CmsObjectControllerFactory" ["Core\Controller\CmsObjectAdminController"]=> string(55) "Core\Factory\Controller\CmsObjectAdminControllerFactory" ["Core\Controller\CmsObjectTypeController"]=> string(54) "Core\Factory\Controller\CmsObjectTypeControllerFactory" ["Core\Controller\CmsObjectTypeAdminController"]=> string(59) "Core\Factory\Controller\CmsObjectTypeAdminControllerFactory" ["Core\Controller\CmsObjectPropertyController"]=> string(58) "Core\Factory\Controller\CmsObjectPropertyControllerFactory" ["Core\Controller\CmsObjectPropertyAdminController"]=> string(63) "Core\Factory\Controller\CmsObjectPropertyAdminControllerFactory" ["Core\Controller\CmsObjectPropertyTypeController"]=> string(62) "Core\Factory\Controller\CmsObjectPropertyTypeControllerFactory" ["Core\Controller\CmsObjectPropertyTypeAdminController"]=> string(67) "Core\Factory\Controller\CmsObjectPropertyTypeAdminControllerFactory" ["Core\Controller\CmsUserController"]=> string(48) "Core\Factory\Controller\CmsUserControllerFactory" ["Core\Controller\CmsUserAdminController"]=> string(53) "Core\Factory\Controller\CmsUserAdminControllerFactory" ["Core\Controller\ControllerActionController"]=> string(57) "Core\Factory\Controller\ControllerActionControllerFactory" ["Core\Controller\ControllerActionAdminController"]=> string(62) "Core\Factory\Controller\ControllerActionAdminControllerFactory" ["Core\Controller\ControllerActionTemplateController"]=> string(65) "Core\Factory\Controller\ControllerActionTemplateControllerFactory" ["Core\Controller\ControllerActionTemplateAdminController"]=> string(70) "Core\Factory\Controller\ControllerActionTemplateAdminControllerFactory" ["Core\Controller\CurrencyController"]=> string(49) "Core\Factory\Controller\CurrencyControllerFactory" ["Core\Controller\CurrencyAdminController"]=> string(54) "Core\Factory\Controller\CurrencyAdminControllerFactory" ["Core\Controller\CityController"]=> string(45) "Core\Factory\Controller\CityControllerFactory" ["Core\Controller\CityAdminController"]=> string(50) "Core\Factory\Controller\CityAdminControllerFactory" ["Core\Controller\ContinentController"]=> string(50) "Core\Factory\Controller\ContinentControllerFactory" ["Core\Controller\ContinentAdminController"]=> string(55) "Core\Factory\Controller\ContinentAdminControllerFactory" ["Core\Controller\CountryController"]=> string(48) "Core\Factory\Controller\CountryControllerFactory" ["Core\Controller\CountryAdminController"]=> string(53) "Core\Factory\Controller\CountryAdminControllerFactory" ["Core\Controller\DebugIpController"]=> string(48) "Core\Factory\Controller\DebugIpControllerFactory" ["Core\Controller\DebugIpAdminController"]=> string(53) "Core\Factory\Controller\DebugIpAdminControllerFactory" ["Core\Controller\DeliveryTypeController"]=> string(53) "Core\Factory\Controller\DeliveryTypeControllerFactory" ["Core\Controller\DeliveryTypeAdminController"]=> string(58) "Core\Factory\Controller\DeliveryTypeAdminControllerFactory" ["Core\Controller\EmailController"]=> string(46) "Core\Factory\Controller\EmailControllerFactory" ["Core\Controller\EmailAdminController"]=> string(51) "Core\Factory\Controller\EmailAdminControllerFactory" ["Core\Controller\EmailTypeController"]=> string(50) "Core\Factory\Controller\EmailTypeControllerFactory" ["Core\Controller\EmailTypeAdminController"]=> string(55) "Core\Factory\Controller\EmailTypeAdminControllerFactory" ["Core\Controller\EntityRightController"]=> string(52) "Core\Factory\Controller\EntityRightControllerFactory" ["Core\Controller\EntityRightAdminController"]=> string(57) "Core\Factory\Controller\EntityRightAdminControllerFactory" ["Core\Controller\ExtranetUserController"]=> string(53) "Core\Factory\Controller\ExtranetUserControllerFactory" ["Core\Controller\ExtranetUserAdminController"]=> string(58) "Core\Factory\Controller\ExtranetUserAdminControllerFactory" ["Core\Controller\FormController"]=> string(45) "Core\Factory\Controller\FormControllerFactory" ["Core\Controller\FormAdminController"]=> string(50) "Core\Factory\Controller\FormAdminControllerFactory" ["Core\Controller\FormFieldsetController"]=> string(53) "Core\Factory\Controller\FormFieldsetControllerFactory" ["Core\Controller\FormFieldsetAdminController"]=> string(58) "Core\Factory\Controller\FormFieldsetAdminControllerFactory" ["Core\Controller\FormFieldController"]=> string(50) "Core\Factory\Controller\FormFieldControllerFactory" ["Core\Controller\FormFieldAdminController"]=> string(55) "Core\Factory\Controller\FormFieldAdminControllerFactory" ["Core\Controller\LanguageController"]=> string(49) "Core\Factory\Controller\LanguageControllerFactory" ["Core\Controller\LanguageAdminController"]=> string(54) "Core\Factory\Controller\LanguageAdminControllerFactory" ["Core\Controller\LibraryController"]=> string(48) "Core\Factory\Controller\LibraryControllerFactory" ["Core\Controller\LibraryAdminController"]=> string(53) "Core\Factory\Controller\LibraryAdminControllerFactory" ["Core\Controller\LibraryTypeController"]=> string(52) "Core\Factory\Controller\LibraryTypeControllerFactory" ["Core\Controller\LibraryTypeAdminController"]=> string(57) "Core\Factory\Controller\LibraryTypeAdminControllerFactory" ["Core\Controller\LibraryItemController"]=> string(52) "Core\Factory\Controller\LibraryItemControllerFactory" ["Core\Controller\LibraryItemAdminController"]=> string(57) "Core\Factory\Controller\LibraryItemAdminControllerFactory" ["Core\Controller\LibraryItemTypeController"]=> string(56) "Core\Factory\Controller\LibraryItemTypeControllerFactory" ["Core\Controller\LibraryItemTypeAdminController"]=> string(61) "Core\Factory\Controller\LibraryItemTypeAdminControllerFactory" ["Core\Controller\MessageController"]=> string(48) "Core\Factory\Controller\MessageControllerFactory" ["Core\Controller\MessageAdminController"]=> string(53) "Core\Factory\Controller\MessageAdminControllerFactory" ["Core\Controller\ModuleController"]=> string(47) "Core\Factory\Controller\ModuleControllerFactory" ["Core\Controller\ModuleAdminController"]=> string(52) "Core\Factory\Controller\ModuleAdminControllerFactory" ["Core\Controller\ModuleParameterController"]=> string(56) "Core\Factory\Controller\ModuleParameterControllerFactory" ["Core\Controller\ModuleParameterAdminController"]=> string(61) "Core\Factory\Controller\ModuleParameterAdminControllerFactory" ["Core\Controller\PageController"]=> string(45) "Core\Factory\Controller\PageControllerFactory" ["Core\Controller\PageAdminController"]=> string(50) "Core\Factory\Controller\PageAdminControllerFactory" ["Core\Controller\PersonController"]=> string(47) "Core\Factory\Controller\PersonControllerFactory" ["Core\Controller\PersonAdminController"]=> string(52) "Core\Factory\Controller\PersonAdminControllerFactory" ["Core\Controller\PersonRelationController"]=> string(55) "Core\Factory\Controller\PersonRelationControllerFactory" ["Core\Controller\PersonRelationAdminController"]=> string(60) "Core\Factory\Controller\PersonRelationAdminControllerFactory" ["Core\Controller\PhoneController"]=> string(46) "Core\Factory\Controller\PhoneControllerFactory" ["Core\Controller\PhoneAdminController"]=> string(51) "Core\Factory\Controller\PhoneAdminControllerFactory" ["Core\Controller\PhoneTypeController"]=> string(50) "Core\Factory\Controller\PhoneTypeControllerFactory" ["Core\Controller\PhoneTypeAdminController"]=> string(55) "Core\Factory\Controller\PhoneTypeAdminControllerFactory" ["Core\Controller\RightController"]=> string(46) "Core\Factory\Controller\RightControllerFactory" ["Core\Controller\RightAdminController"]=> string(51) "Core\Factory\Controller\RightAdminControllerFactory" ["Core\Controller\RoleController"]=> string(45) "Core\Factory\Controller\RoleControllerFactory" ["Core\Controller\RoleAdminController"]=> string(50) "Core\Factory\Controller\RoleAdminControllerFactory" ["Core\Controller\RoleTypeController"]=> string(49) "Core\Factory\Controller\RoleTypeControllerFactory" ["Core\Controller\RoleTypeAdminController"]=> string(54) "Core\Factory\Controller\RoleTypeAdminControllerFactory" ["Core\Controller\RouteController"]=> string(46) "Core\Factory\Controller\RouteControllerFactory" ["Core\Controller\RouteAdminController"]=> string(51) "Core\Factory\Controller\RouteAdminControllerFactory" ["Core\Controller\ShortUrlController"]=> string(49) "Core\Factory\Controller\ShortUrlControllerFactory" ["Core\Controller\ShortUrlAdminController"]=> string(54) "Core\Factory\Controller\ShortUrlAdminControllerFactory" ["Core\Controller\SiteController"]=> string(45) "Core\Factory\Controller\SiteControllerFactory" ["Core\Controller\SiteAdminController"]=> string(50) "Core\Factory\Controller\SiteAdminControllerFactory" ["Core\Controller\SiteDomainController"]=> string(51) "Core\Factory\Controller\SiteDomainControllerFactory" ["Core\Controller\SiteDomainAdminController"]=> string(56) "Core\Factory\Controller\SiteDomainAdminControllerFactory" ["Core\Controller\StateController"]=> string(46) "Core\Factory\Controller\StateControllerFactory" ["Core\Controller\StateAdminController"]=> string(51) "Core\Factory\Controller\StateAdminControllerFactory" ["Core\Controller\TemplateController"]=> string(49) "Core\Factory\Controller\TemplateControllerFactory" ["Core\Controller\TemplateAdminController"]=> string(54) "Core\Factory\Controller\TemplateAdminControllerFactory" ["Core\Controller\TemplateGroupController"]=> string(54) "Core\Factory\Controller\TemplateGroupControllerFactory" ["Core\Controller\TemplateGroupAdminController"]=> string(59) "Core\Factory\Controller\TemplateGroupAdminControllerFactory" ["Core\Controller\UserController"]=> string(45) "Core\Factory\Controller\UserControllerFactory" ["Core\Controller\UserAdminController"]=> string(50) "Core\Factory\Controller\UserAdminControllerFactory" ["Core\Controller\UserFavoritObjectController"]=> string(58) "Core\Factory\Controller\UserFavoritObjectControllerFactory" ["Core\Controller\UserFavoritObjectAdminController"]=> string(63) "Core\Factory\Controller\UserFavoritObjectAdminControllerFactory" ["Core\Controller\UserRoleController"]=> string(49) "Core\Factory\Controller\UserRoleControllerFactory" ["Core\Controller\UserRoleAdminController"]=> string(54) "Core\Factory\Controller\UserRoleAdminControllerFactory" ["Core\Controller\UserSessionController"]=> string(52) "Core\Factory\Controller\UserSessionControllerFactory" ["Core\Controller\UserSessionAdminController"]=> string(57) "Core\Factory\Controller\UserSessionAdminControllerFactory" ["Core\Controller\UtilityController"]=> string(48) "Core\Factory\Controller\UtilityControllerFactory" ["Core\Controller\WebsiteController"]=> string(48) "Core\Factory\Controller\WebsiteControllerFactory" ["Core\Controller\WebsiteAdminController"]=> string(53) "Core\Factory\Controller\WebsiteAdminControllerFactory" ["Core\Controller\WebsiteTypeController"]=> string(52) "Core\Factory\Controller\WebsiteTypeControllerFactory" ["Core\Controller\WebsiteTypeAdminController"]=> string(57) "Core\Factory\Controller\WebsiteTypeAdminControllerFactory" ["Company\Controller\CompanyModuleController"]=> string(57) "Company\Factory\Controller\CompanyModuleControllerFactory" ["Company\Controller\CompanyController"]=> string(51) "Company\Factory\Controller\CompanyControllerFactory" ["Company\Controller\CompanyAdminController"]=> string(56) "Company\Factory\Controller\CompanyAdminControllerFactory" ["Company\Controller\DomainController"]=> string(50) "Company\Factory\Controller\DomainControllerFactory" ["Company\Controller\DomainAdminController"]=> string(55) "Company\Factory\Controller\DomainAdminControllerFactory" ["Company\Controller\CompanyFunctionController"]=> string(59) "Company\Factory\Controller\CompanyFunctionControllerFactory" ["Company\Controller\CompanyFunctionAdminController"]=> string(64) "Company\Factory\Controller\CompanyFunctionAdminControllerFactory" ["Company\Controller\EmployeeController"]=> string(52) "Company\Factory\Controller\EmployeeControllerFactory" ["Company\Controller\EmployeeAdminController"]=> string(57) "Company\Factory\Controller\EmployeeAdminControllerFactory" ["Company\Controller\ContractController"]=> string(52) "Company\Factory\Controller\ContractControllerFactory" ["Company\Controller\ContractAdminController"]=> string(57) "Company\Factory\Controller\ContractAdminControllerFactory" ["Company\Controller\ContractTypeController"]=> string(56) "Company\Factory\Controller\ContractTypeControllerFactory" ["Company\Controller\ContractTypeAdminController"]=> string(61) "Company\Factory\Controller\ContractTypeAdminControllerFactory" ["Contact\Controller\ContactModuleController"]=> string(57) "Contact\Factory\Controller\ContactModuleControllerFactory" ["Contact\Controller\ContactController"]=> string(51) "Contact\Factory\Controller\ContactControllerFactory" ["Contact\Controller\ContactAdminController"]=> string(56) "Contact\Factory\Controller\ContactAdminControllerFactory" ["Contact\Controller\ContactAnswerController"]=> string(57) "Contact\Factory\Controller\ContactAnswerControllerFactory" ["Contact\Controller\ContactAnswerAdminController"]=> string(62) "Contact\Factory\Controller\ContactAnswerAdminControllerFactory" ["Contact\Controller\ContactCommentController"]=> string(58) "Contact\Factory\Controller\ContactCommentControllerFactory" ["Contact\Controller\ContactCommentAdminController"]=> string(63) "Contact\Factory\Controller\ContactCommentAdminControllerFactory" ["Contact\Controller\ContactStatusController"]=> string(57) "Contact\Factory\Controller\ContactStatusControllerFactory" ["Contact\Controller\ContactStatusAdminController"]=> string(62) "Contact\Factory\Controller\ContactStatusAdminControllerFactory" ["Galleries\Controller\GalleriesModuleController"]=> string(61) "Galleries\Factory\Controller\GalleriesModuleControllerFactory" ["Galleries\Controller\GalleryController"]=> string(53) "Galleries\Factory\Controller\GalleryControllerFactory" ["Galleries\Controller\GalleryAdminController"]=> string(58) "Galleries\Factory\Controller\GalleryAdminControllerFactory" ["Galleries\Controller\ItemController"]=> string(50) "Galleries\Factory\Controller\ItemControllerFactory" ["Galleries\Controller\ItemAdminController"]=> string(55) "Galleries\Factory\Controller\ItemAdminControllerFactory" ["Galleries\Controller\ItemTypeController"]=> string(54) "Galleries\Factory\Controller\ItemTypeControllerFactory" ["Galleries\Controller\ItemTypeAdminController"]=> string(59) "Galleries\Factory\Controller\ItemTypeAdminControllerFactory" ["Galleries\Controller\ItemCommentController"]=> string(57) "Galleries\Factory\Controller\ItemCommentControllerFactory" ["Galleries\Controller\ItemCommentAdminController"]=> string(62) "Galleries\Factory\Controller\ItemCommentAdminControllerFactory" ["Logs\Controller\LogsModuleController"]=> string(51) "Logs\Factory\Controller\LogsModuleControllerFactory" ["Logs\Controller\LogController"]=> string(44) "Logs\Factory\Controller\LogControllerFactory" ["Logs\Controller\LogAdminController"]=> string(49) "Logs\Factory\Controller\LogAdminControllerFactory" ["Menu\Controller\MenuModuleController"]=> string(51) "Menu\Factory\Controller\MenuModuleControllerFactory" ["Menu\Controller\MenuController"]=> string(45) "Menu\Factory\Controller\MenuControllerFactory" ["Menu\Controller\MenuAdminController"]=> string(50) "Menu\Factory\Controller\MenuAdminControllerFactory" ["Menu\Controller\MenuItemController"]=> string(49) "Menu\Factory\Controller\MenuItemControllerFactory" ["Menu\Controller\MenuItemAdminController"]=> string(54) "Menu\Factory\Controller\MenuItemAdminControllerFactory" ["Widget\Controller\WidgetModuleController"]=> string(55) "Widget\Factory\Controller\WidgetModuleControllerFactory" ["Widget\Controller\WidgetController"]=> string(49) "Widget\Factory\Controller\WidgetControllerFactory" ["Widget\Controller\WidgetAdminController"]=> string(54) "Widget\Factory\Controller\WidgetAdminControllerFactory" ["Widget\Controller\WidgetPositionController"]=> string(57) "Widget\Factory\Controller\WidgetPositionControllerFactory" ["Widget\Controller\WidgetPositionAdminController"]=> string(62) "Widget\Factory\Controller\WidgetPositionAdminControllerFactory" ["Search\Controller\SearchController"]=> string(49) "Search\Factory\Controller\SearchControllerFactory" ["Products\Controller\ProductsModuleController"]=> string(59) "Products\Factory\Controller\ProductsModuleControllerFactory" ["Products\Controller\ProductController"]=> string(52) "Products\Factory\Controller\ProductControllerFactory" ["Products\Controller\ProductAdminController"]=> string(57) "Products\Factory\Controller\ProductAdminControllerFactory" ["Products\Controller\CategoryController"]=> string(53) "Products\Factory\Controller\CategoryControllerFactory" ["Products\Controller\CategoryAdminController"]=> string(58) "Products\Factory\Controller\CategoryAdminControllerFactory" ["Products\Controller\ProductTypeController"]=> string(56) "Products\Factory\Controller\ProductTypeControllerFactory" ["Products\Controller\ProductTypeAdminController"]=> string(61) "Products\Factory\Controller\ProductTypeAdminControllerFactory" ["Products\Controller\BrandController"]=> string(50) "Products\Factory\Controller\BrandControllerFactory" ["Products\Controller\BrandAdminController"]=> string(55) "Products\Factory\Controller\BrandAdminControllerFactory" ["Products\Controller\CriteriaController"]=> string(53) "Products\Factory\Controller\CriteriaControllerFactory" ["Products\Controller\CriteriaAdminController"]=> string(58) "Products\Factory\Controller\CriteriaAdminControllerFactory" ["Shop\Controller\ShopModuleController"]=> string(51) "Shop\Factory\Controller\ShopModuleControllerFactory" ["Shop\Controller\ShopController"]=> string(45) "Shop\Factory\Controller\ShopControllerFactory" ["Shop\Controller\ShopAdminController"]=> string(50) "Shop\Factory\Controller\ShopAdminControllerFactory" ["Shop\Controller\ShopProductController"]=> string(52) "Shop\Factory\Controller\ShopProductControllerFactory" ["Shop\Controller\ShopProductAdminController"]=> string(57) "Shop\Factory\Controller\ShopProductAdminControllerFactory" ["Shop\Controller\CategoryController"]=> string(49) "Shop\Factory\Controller\CategoryControllerFactory" ["Shop\Controller\CategoryAdminController"]=> string(54) "Shop\Factory\Controller\CategoryAdminControllerFactory" ["Shop\Controller\OrderController"]=> string(46) "Shop\Factory\Controller\OrderControllerFactory" ["Shop\Controller\OrderAdminController"]=> string(51) "Shop\Factory\Controller\OrderAdminControllerFactory" ["Shop\Controller\OrderItemController"]=> string(50) "Shop\Factory\Controller\OrderItemControllerFactory" ["Shop\Controller\OrderItemAdminController"]=> string(55) "Shop\Factory\Controller\OrderItemAdminControllerFactory" ["Shop\Controller\TaxController"]=> string(44) "Shop\Factory\Controller\TaxControllerFactory" ["Shop\Controller\TaxAdminController"]=> string(49) "Shop\Factory\Controller\TaxAdminControllerFactory" ["Shop\Controller\TaxGroupController"]=> string(49) "Shop\Factory\Controller\TaxGroupControllerFactory" ["Shop\Controller\TaxGroupAdminController"]=> string(54) "Shop\Factory\Controller\TaxGroupAdminControllerFactory" ["Shop\Controller\TaxRuleController"]=> string(48) "Shop\Factory\Controller\TaxRuleControllerFactory" ["Shop\Controller\TaxRuleAdminController"]=> string(53) "Shop\Factory\Controller\TaxRuleAdminControllerFactory" ["Shop\Controller\PriceTableController"]=> string(51) "Shop\Factory\Controller\PriceTableControllerFactory" ["Shop\Controller\PriceTableAdminController"]=> string(56) "Shop\Factory\Controller\PriceTableAdminControllerFactory" ["Shop\Controller\PriceTableConditionnementController"]=> string(66) "Shop\Factory\Controller\PriceTableConditionnementControllerFactory" ["Shop\Controller\PriceTableConditionnementAdminController"]=> string(71) "Shop\Factory\Controller\PriceTableConditionnementAdminControllerFactory" ["Shop\Controller\WishListController"]=> string(49) "Shop\Factory\Controller\WishListControllerFactory" ["Shop\Controller\WishListAdminController"]=> string(54) "Shop\Factory\Controller\WishListAdminControllerFactory" ["Shop\Controller\PromotionController"]=> string(50) "Shop\Factory\Controller\PromotionControllerFactory" ["Shop\Controller\PromotionAdminController"]=> string(55) "Shop\Factory\Controller\PromotionAdminControllerFactory" ["Shop\Controller\PromotionItemController"]=> string(54) "Shop\Factory\Controller\PromotionItemControllerFactory" ["Shop\Controller\PromotionItemAdminController"]=> string(59) "Shop\Factory\Controller\PromotionItemAdminControllerFactory" ["Shop\Controller\CartController"]=> string(45) "Shop\Factory\Controller\CartControllerFactory" ["Shop\Controller\CartAdminController"]=> string(50) "Shop\Factory\Controller\CartAdminControllerFactory" ["Shop\Controller\CartItemController"]=> string(49) "Shop\Factory\Controller\CartItemControllerFactory" ["Shop\Controller\CartItemAdminController"]=> string(54) "Shop\Factory\Controller\CartItemAdminControllerFactory" ["Shop\Controller\CartConstraintController"]=> string(55) "Shop\Factory\Controller\CartConstraintControllerFactory" ["Shop\Controller\CartConstraintAdminController"]=> string(60) "Shop\Factory\Controller\CartConstraintAdminControllerFactory" ["Shop\Controller\CartRuleController"]=> string(49) "Shop\Factory\Controller\CartRuleControllerFactory" ["Shop\Controller\CartRuleAdminController"]=> string(54) "Shop\Factory\Controller\CartRuleAdminControllerFactory" ["Shop\Controller\CartRuleRestrictionController"]=> string(60) "Shop\Factory\Controller\CartRuleRestrictionControllerFactory" ["Shop\Controller\CartRuleRestrictionAdminController"]=> string(65) "Shop\Factory\Controller\CartRuleRestrictionAdminControllerFactory" ["Shop\Controller\OrderCartRuleController"]=> string(54) "Shop\Factory\Controller\OrderCartRuleControllerFactory" ["Shop\Controller\OrderCartRuleAdminController"]=> string(59) "Shop\Factory\Controller\OrderCartRuleAdminControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionController"]=> string(65) "Shop\Factory\Controller\OrderCartRuleRestrictionControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionAdminController"]=> string(70) "Shop\Factory\Controller\OrderCartRuleRestrictionAdminControllerFactory" ["ShopWinBiz\Controller\WinBizController"]=> string(53) "ShopWinBiz\Factory\Controller\WinBizControllerFactory" ["Payments\Controller\PaymentsModuleController"]=> string(59) "Payments\Factory\Controller\PaymentsModuleControllerFactory" ["Payments\Controller\PaymentController"]=> string(52) "Payments\Factory\Controller\PaymentControllerFactory" ["Payments\Controller\PaymentAdminController"]=> string(57) "Payments\Factory\Controller\PaymentAdminControllerFactory" ["Payments\Controller\PaymentTypeController"]=> string(56) "Payments\Factory\Controller\PaymentTypeControllerFactory" ["Payments\Controller\PaymentTypeAdminController"]=> string(61) "Payments\Factory\Controller\PaymentTypeAdminControllerFactory" ["Testimonials\Controller\TestimonialsModuleController"]=> string(67) "Testimonials\Factory\Controller\TestimonialsModuleControllerFactory" ["Testimonials\Controller\TestimonialController"]=> string(60) "Testimonials\Factory\Controller\TestimonialControllerFactory" ["Testimonials\Controller\TestimonialAdminController"]=> string(65) "Testimonials\Factory\Controller\TestimonialAdminControllerFactory" ["Checkout\Controller\PaymentController"]=> string(52) "Checkout\Factory\Controller\PaymentControllerFactory" } ["invokables"]=> array(45) { ["MyFirstPlugin"]=> string(36) "Core\Controller\Plugin\MyFirstPlugin" ["Core\Controller\Core"]=> string(30) "Core\Controller\CoreController" ["Core\Controller\LibraryAdmin"]=> string(38) "Core\Controller\LibraryAdminController" ["Core\Controller\Debug"]=> string(31) "Core\Controller\DebugController" ["Core\Controller\Desktop"]=> string(33) "Core\Controller\DesktopController" ["Core\Controller\Diploma"]=> string(38) "Core\Controller\DiplomaAdminController" ["Core\Controller\UnitTest\CoreUnitTest"]=> string(47) "Core\Controller\UnitTest\CoreUnitTestController" ["Core\Controller\UnitTest\CoreAddressUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreAddressUnitTestController" ["Core\Controller\UnitTest\CoreAddressTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreAddressTypeUnitTestController" ["Core\Controller\UnitTest\CoreAjaxRightUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreAjaxRightUnitTestController" ["Core\Controller\UnitTest\CoreContentUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreContentUnitTestController" ["Core\Controller\UnitTest\CoreCurrencyUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreCurrencyUnitTestController" ["Core\Controller\UnitTest\CoreDeliveryTypeUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreDeliveryTypeUnitTestController" ["Core\Controller\UnitTest\CoreEmailUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreEmailUnitTestController" ["Core\Controller\UnitTest\CoreEmailTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreEmailTypeUnitTestController" ["Core\Controller\UnitTest\CoreFormUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreFormUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreFormFieldUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldsetUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreFormFieldsetUnitTestController" ["Core\Controller\UnitTest\CoreLanguageUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreLanguageUnitTestController" ["Core\Controller\UnitTest\CoreLibraryUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreLibraryUnitTestController" ["Core\Controller\UnitTest\CoreLibraryTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryTypeUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryItemUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemTypeUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreLibraryItemTypeUnitTestController" ["Core\Controller\UnitTest\CoreMessageUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreMessageUnitTestController" ["Core\Controller\UnitTest\CoreModuleUnitTest"]=> string(53) "Core\Controller\UnitTest\CoreModuleUnitTestController" ["Core\Controller\UnitTest\CoreModuleParameterUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreModuleParameterUnitTestController" ["Core\Controller\UnitTest\CorePageUnitTest"]=> string(51) "Core\Controller\UnitTest\CorePageUnitTestController" ["Core\Controller\UnitTest\CorePersonUnitTest"]=> string(53) "Core\Controller\UnitTest\CorePersonUnitTestController" ["Core\Controller\UnitTest\CorePersonRelationUnitTest"]=> string(61) "Core\Controller\UnitTest\CorePersonRelationUnitTestController" ["Core\Controller\UnitTest\CorePhoneUnitTest"]=> string(52) "Core\Controller\UnitTest\CorePhoneUnitTestController" ["Core\Controller\UnitTest\CorePhoneTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CorePhoneTypeUnitTestController" ["Core\Controller\UnitTest\CoreRightUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreRightUnitTestController" ["Core\Controller\UnitTest\CoreRoleUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreRoleUnitTestController" ["Core\Controller\UnitTest\CoreRoleTypeUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreRoleTypeUnitTestController" ["Core\Controller\UnitTest\CoreTemplateUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreTemplateUnitTestController" ["Core\Controller\UnitTest\CoreTemplateGroupUnitTest"]=> string(60) "Core\Controller\UnitTest\CoreTemplateGroupUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreWebsiteUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreWebsiteTypeUnitTestController" ["QRCode\Controller\QRCode"]=> string(34) "QRCode\Controller\QRCodeController" ["QRCode\Controller\QRCodeAdmin"]=> string(39) "QRCode\Controller\QRCodeAdminController" ["QRCode\Controller\Access"]=> string(34) "QRCode\Controller\AccessController" ["QRCode\Controller\AccessAdmin"]=> string(39) "QRCode\Controller\AccessAdminController" ["Search\Controller\Search"]=> string(34) "Search\Controller\SearchController" ["Search\Controller\Index"]=> string(33) "Search\Controller\IndexController" ["Search\Controller\IndexAdmin"]=> string(38) "Search\Controller\IndexAdminController" } } ["translator"]=> array(2) { ["locale"]=> string(5) "fr_FR" ["translation_file_patterns"]=> array(1) { [0]=> array(3) { ["type"]=> string(7) "gettext" ["base_dir"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Core/config/../translations" ["pattern"]=> string(5) "%s.mo" } } } ["view_manager"]=> array(8) { ["doctype"]=> string(5) "HTML5" ["strategies"]=> array(1) { [0]=> string(16) "ViewJsonStrategy" } ["template_path_stack"]=> array(21) { ["core"]=> string(107) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/layouts" ["company"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Company/config/../view" ["shopstructureddata"]=> string(132) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopStructuredData/config/../view" ["contact"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Contact/config/../view" ["galleries"]=> string(123) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Galleries/config/../view" ["logs"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Logs/config/../view" ["menu"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Menu/config/../view" ["qrcode"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/QRCode/config/../view" ["widget"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Widget/config/../view" ["search"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Search/config/../view" ["products"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Products/config/../view" ["shop"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/config/../view" ["shopwinbiz"]=> string(124) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopWinBiz/config/../view" ["payments"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Payments/config/../view" ["testimonials"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Testimonials/config/../view" ["shopanalytics"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopAnalytics/config/../view" ["checkout"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Checkout/config/../view" ["Caveschateauauvernier"]=> string(149) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/specific_site/module/Caveschateauauvernier/config/../view" ["views"]=> string(104) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view" ["layouts"]=> string(117) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas" ["customlayouts"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" } ["template_map"]=> array(3) { ["error/404"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/404.phtml" ["layout/layout"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/500.phtml" ["error/index"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view/core/error/index.phtml" } ["not_found_template"]=> string(9) "error/404" ["exception_template"]=> string(11) "error/index" ["display_not_found_reason"]=> bool(true) ["display_exceptions"]=> bool(true) } ["navigation"]=> array(0) { } ["sentry"]=> array(2) { ["disable_module"]=> bool(false) ["options"]=> array(1) { ["dsn"]=> string(74) "https://0b5c664cafc349c5a5bed8048da6e011@o1176727.ingest.sentry.io/6276660" } } ["cache_rights"]=> bool(false) ["ajaxAdmin"]=> bool(true) ["externalModules"]=> bool(true) ["base_url"]=> string(2) "./" ["debug"]=> bool(true) ["defaultSiteName"]=> string(16) "chateauauvernier" ["defaultSiteId"]=> int(1) ["defaultHost"]=> string(24) "new.chateau-auvernier.ch" ["defaultIp"]=> string(9) "" ["defaultUserGroup"]=> int(1) ["rootPath"]=> string(79) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current" ["publicPath"]=> string(93) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public" ["dataPath"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data" ["applicationPath"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module" ["cssResourcesCachePath"]=> string(103) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/css/cache" ["jsResourcesCachePath"]=> string(102) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/js/cache" ["resourcesExpirationTime"]=> string(29) "Tue, 04 Jul 2023 15:57:49 GMT" ["displaySitenameInUrl"]=> bool(false) ["logging"]=> array(4) { ["enabled"]=> bool(true) ["level"]=> int(3) ["fileName"]=> string(8) "site.log" ["path"]=> string(109) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/logs/chateauauvernier" } ["phpSettings"]=> array(4) { ["max_execution_time"]=> int(600) ["date.timezone"]=> string(13) "Europe/Zurich" ["display_startup_errors"]=> bool(true) ["display_errors"]=> bool(true) } ["db"]=> array(6) { ["driver"]=> string(3) "Pdo" ["dsn"]=> string(68) "mysql:dbname=dlxu_shop_chateauauvernier;host=dlxu.myd.infomaniak.com" ["driver_options"]=> array(3) { [1002]=> string(32) "SET NAMES 'UTF8', sql_mode = '';" [17]=> bool(false) [20]=> bool(false) } ["adapters"]=> array(1) { ["cmsAdapter"]=> array(4) { ["driver"]=> string(3) "Pdo" ["username"]=> string(0) "" ["password"]=> string(0) "" ["dsn"]=> string(19) "mysql:dbname=;host=" } } ["username"]=> string(15) "dlxu_shopdbuser" ["password"]=> string(12) "l_OSuAOz3kqr" } ["cache_path"]=> string(98) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data/cache" ["cache_type"]=> string(10) "filesystem" ["cmsversion"]=> float(4) ["debugemail"]=> bool(false) ["dbdebug"]=> bool(false) ["dev"]=> bool(true) ["templatePath"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" ["templateName"]=> string(9) "shopgrids" ["privatePath"]=> string(87) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private" ["sessionLifeTime"]=> string(4) "1440" } ["init":"Core\Module":private]=> bool(false) ["adminPage":"Core\Module":private]=> bool(false) ["isAjax":"Core\Module":private]=> bool(false) ["acl":"Core\Module":private]=> object(Shop\Model\Services\Override\Acl)#1425 (8) { ["serviceManager":protected]=> *RECURSION* ["redirectTo":protected]=> string(14) "/en/connection" ["roleRegistry":protected]=> NULL ["resources":protected]=> array(0) { } ["isAllowedRole":protected]=> NULL ["isAllowedResource":protected]=> NULL ["isAllowedPrivilege":protected]=> NULL ["rules":protected]=> array(2) { ["allResources"]=> array(2) { ["allRoles"]=> array(2) { ["allPrivileges"]=> array(2) { ["type"]=> string(9) "TYPE_DENY" ["assert"]=> NULL } ["byPrivilegeId"]=> array(0) { } } ["byRoleId"]=> array(0) { } } ["byResourceId"]=> array(0) { } } } ["tmpTest":"Core\Module":private]=> NULL ["initAjax"]=> int(0) } ["parameter"]=> array(1) { ["$sm"]=> string(10) "" } } ["Core\Admin\Form\AddressTypeForm"]=> object(Closure)#54 (2) { ["this"]=> object(Core\Module)#50 (11) { ["defaultAdminLanguage":"Core\Module":private]=> string(2) "fr" ["requestedCmsObject":"Core\Module":private]=> object(Core\Model\Domain\CmsObject)#1164 (30) { ["objectId"]=> string(25) "EN_549296cbd43ea385133062" ["parentObjectId"]=> string(25) "EN_548aaba3ef08d749124007" ["objectTypeId"]=> string(1) "2" ["lngUnId"]=> string(22) "549296cbd43ea385133062" ["languageId"]=> string(2) "42" ["siteId"]=> string(1) "1" ["templateId"]=> string(2) "43" ["templateGroupId"]=> string(1) "1" ["last"]=> int(1) ["version"]=> int(1) ["active"]=> int(1) ["url"]=> string(0) "" ["status"]=> int(2) ["statusUserId"]=> string(1) "0" ["deleted"]=> int(0) ["deletedBy"]=> string(1) "0" ["published"]=> int(1) ["publishedBy"]=> string(1) "1" ["creationDate"]=> string(19) "2014-12-18 09:56:43" ["createdBy"]=> string(1) "1" ["updateDate"]=> string(19) "2014-12-18 09:56:43" ["updatedBy"]=> string(1) "1" ["publicationDateFrom"]=> string(19) "0000-00-00 00:00:00" ["publicationDateTo"]=> string(19) "0000-00-00 00:00:00" ["owner"]=> string(1) "1" ["displayOrder"]=> int(0) ["objectUrl"]=> NULL ["objectsFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } ["fieldsMap":protected]=> array(27) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" ["objectUrl"]=> string(10) "object_url" } ["localFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } } ["requestedObject":"Core\Module":private]=> NULL ["requestServerData":"Core\Module":private]=> object(Laminas\Stdlib\Parameters)#610 (1) { ["storage":"ArrayObject":private]=> array(62) { ["TEMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMPDIR"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["ORIG_SCRIPT_NAME"]=> string(19) "/.fpm/php5.external" ["ORIG_PATH_TRANSLATED"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["ORIG_PATH_INFO"]=> string(17) "/public/index.php" ["ORIG_SCRIPT_FILENAME"]=> string(105) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/php5.external" ["SCRIPT_NAME"]=> string(17) "/public/index.php" ["REQUEST_URI"]=> string(58) "/en/shop/detailsen?id=6253d9fcc47bc657111855&catname=wines" ["QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REQUEST_METHOD"]=> string(3) "GET" ["SERVER_PROTOCOL"]=> string(8) "HTTP/1.1" ["GATEWAY_INTERFACE"]=> string(7) "CGI/1.1" ["REDIRECT_QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REDIRECT_URL"]=> string(17) "/public/index.php" ["REMOTE_PORT"]=> string(5) "58056" ["SCRIPT_FILENAME"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["SERVER_ADMIN"]=> string(30) "webmaster@chateau-auvernier.ch" ["CONTEXT_DOCUMENT_ROOT"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/" ["CONTEXT_PREFIX"]=> string(6) "/.fpm/" ["REQUEST_SCHEME"]=> string(5) "https" ["DOCUMENT_ROOT"]=> string(77) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch" ["REMOTE_ADDR"]=> string(33) "2001:1600:4:b:1a66:daff:fe53:6382" ["SERVER_PORT"]=> string(3) "443" ["SERVER_ADDR"]=> string(10) "" ["SERVER_NAME"]=> string(20) "chateau-auvernier.ch" ["SERVER_SOFTWARE"]=> string(6) "Apache" ["SERVER_SIGNATURE"]=> string(0) "" ["PATH"]=> string(60) "/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin" ["HTTP_X_FORWARDED_PROTO"]=> string(5) "https" ["HTTP_CONNECTION"]=> string(5) "close" ["HTTP_X_FORWARDED_SERVER"]=> string(24) "new.chateau-auvernier.ch" ["HTTP_X_FORWARDED_HOST"]=> string(20) "chateau-auvernier.ch" ["HTTP_X_FORWARDED_FOR"]=> string(12) "" ["HTTP_ACCEPT_ENCODING"]=> string(7) "br,gzip" ["HTTP_ACCEPT_LANGUAGE"]=> string(14) "en-US,en;q=0.5" ["HTTP_ACCEPT"]=> string(63) "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8" ["HTTP_USER_AGENT"]=> string(40) "CCBot/2.0 (https://commoncrawl.org/faq/)" ["HTTP_HOST"]=> string(20) "chateau-auvernier.ch" ["PHP_VERSION"]=> string(3) "8.0" ["SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["HTTPS"]=> string(2) "on" ["UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_HANDLER"]=> string(9) "php5-fcgi" ["REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_REDIRECT_proto"]=> string(5) "https" ["REDIRECT_REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["FCGI_ROLE"]=> string(9) "RESPONDER" ["PHP_SELF"]=> string(17) "/public/index.php" ["REQUEST_TIME_FLOAT"]=> float(1656950269.863278) ["REQUEST_TIME"]=> int(1656950269) } } ["config":"Core\Module":private]=> array(45) { ["service_manager"]=> array(4) { ["abstract_factories"]=> array(6) { [0]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [1]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [2]=> string(51) "Laminas\Di\Container\ServiceManager\AutowireFactory" [3]=> string(39) "Laminas\Form\FormAbstractServiceFactory" [4]=> string(59) "Laminas\Navigation\Service\NavigationAbstractServiceFactory" [5]=> string(48) "Laminas\Db\Adapter\AdapterAbstractServiceFactory" } ["factories"]=> array(401) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> string(56) "Laminas\Cache\Service\StorageAdapterPluginManagerFactory" ["Laminas\Cache\Storage\PluginManager"]=> string(49) "Laminas\Cache\Service\StoragePluginManagerFactory" ["Laminas\Cache\Service\StoragePluginFactory"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StoragePluginFactoryInterface"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactory"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactoryInterface"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Di\InjectorInterface"]=> string(36) "Laminas\Di\Container\InjectorFactory" ["Laminas\Di\ConfigInterface"]=> string(34) "Laminas\Di\Container\ConfigFactory" ["Laminas\Di\CodeGenerator\InjectorGenerator"]=> string(37) "Laminas\Di\Container\GeneratorFactory" ["Laminas\Mvc\I18n\Translator"]=> string(34) "Laminas\Mvc\I18n\TranslatorFactory" ["Laminas\InputFilter\InputFilterPluginManager"]=> string(51) "Laminas\InputFilter\InputFilterPluginManagerFactory" ["SerializerAdapterManager"]=> string(46) "Laminas\Serializer\AdapterPluginManagerFactory" ["Laminas\Router\Http\TreeRouteStack"]=> string(37) "Laminas\Router\Http\HttpRouterFactory" ["Laminas\Router\RoutePluginManager"]=> string(40) "Laminas\Router\RoutePluginManagerFactory" ["Laminas\Router\RouteStackInterface"]=> string(28) "Laminas\Router\RouterFactory" ["FormAnnotationBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormAttributeBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormElementManager"]=> string(38) "Laminas\Form\FormElementManagerFactory" ["Laminas\Validator\ValidatorPluginManager"]=> string(47) "Laminas\Validator\ValidatorPluginManagerFactory" ["Laminas\Mail\Protocol\SmtpPluginManager"]=> string(46) "Laminas\Mail\Protocol\SmtpPluginManagerFactory" ["Laminas\I18n\Translator\TranslatorInterface"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["Laminas\I18n\Translator\LoaderPluginManager"]=> string(50) "Laminas\I18n\Translator\LoaderPluginManagerFactory" ["Laminas\Navigation\Navigation"]=> string(51) "Laminas\Navigation\Service\DefaultNavigationFactory" ["main-navigation"]=> string(34) "Core\Factory\MainNavigationFactory" ["admin-navigation"]=> string(39) "Core\Factory\AdminMainNavigationFactory" ["translator"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["CoreManager"]=> string(39) "Core\Factory\Manager\CoreManagerFactory" ["Core\Model\Services\ControllerActionManagerLaminas"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDaoLaminas"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["ControllerActionGatewayLaminas"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\PageManagerLaminas"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDaoLaminas"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["PageGatewayLaminas"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\CmsObjectManager"]=> string(44) "Core\Factory\Manager\CmsObjectManagerFactory" ["Core\Model\Dao\CmsObjectDao"]=> string(36) "Core\Factory\Dao\CmsObjectDaoFactory" ["CmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\AddressManager"]=> string(42) "Core\Factory\Manager\AddressManagerFactory" ["Core\Model\Dao\AddressDao"]=> string(34) "Core\Factory\Dao\AddressDaoFactory" ["CoreAddressGateway"]=> string(42) "Core\Factory\Gateway\AddressGatewayFactory" ["Core\Model\Services\AddressTypeManager"]=> string(46) "Core\Factory\Manager\AddressTypeManagerFactory" ["Core\Model\Dao\AddressTypeDao"]=> string(38) "Core\Factory\Dao\AddressTypeDaoFactory" ["CoreAddressTypeGateway"]=> string(46) "Core\Factory\Gateway\AddressTypeGatewayFactory" ["Core\Model\Services\AjaxRightManager"]=> string(44) "Core\Factory\Manager\AjaxRightManagerFactory" ["Core\Model\Dao\AjaxRightDao"]=> string(36) "Core\Factory\Dao\AjaxRightDaoFactory" ["CoreAjaxRightGateway"]=> string(44) "Core\Factory\Gateway\AjaxRightGatewayFactory" ["Core\Model\Services\BankManager"]=> string(39) "Core\Factory\Manager\BankManagerFactory" ["Core\Model\Dao\BankDao"]=> string(31) "Core\Factory\Dao\BankDaoFactory" ["CoreBankGateway"]=> string(39) "Core\Factory\Gateway\BankGatewayFactory" ["Core\Model\Services\BankAccountManager"]=> string(46) "Core\Factory\Manager\BankAccountManagerFactory" ["Core\Model\Dao\BankAccountDao"]=> string(38) "Core\Factory\Dao\BankAccountDaoFactory" ["CoreBankAccountGateway"]=> string(46) "Core\Factory\Gateway\BankAccountGatewayFactory" ["Core\Model\Services\BankAddressManager"]=> string(46) "Core\Factory\Manager\BankAddressManagerFactory" ["Core\Model\Dao\BankAddressDao"]=> string(38) "Core\Factory\Dao\BankAddressDaoFactory" ["CoreBankAddressGateway"]=> string(46) "Core\Factory\Gateway\BankAddressGatewayFactory" ["Core\Model\Services\CertificateManager"]=> string(46) "Core\Factory\Manager\CertificateManagerFactory" ["Core\Model\Dao\CertificateDao"]=> string(38) "Core\Factory\Dao\CertificateDaoFactory" ["CoreCertificateGateway"]=> string(46) "Core\Factory\Gateway\CertificateGatewayFactory" ["Core\Model\Services\ClosedDayManager"]=> string(44) "Core\Factory\Manager\ClosedDayManagerFactory" ["Core\Model\Dao\ClosedDayDao"]=> string(36) "Core\Factory\Dao\ClosedDayDaoFactory" ["CoreClosedDayGateway"]=> string(44) "Core\Factory\Gateway\ClosedDayGatewayFactory" ["Core\Model\Services\ClosedDayTypeManager"]=> string(48) "Core\Factory\Manager\ClosedDayTypeManagerFactory" ["Core\Model\Dao\ClosedDayTypeDao"]=> string(40) "Core\Factory\Dao\ClosedDayTypeDaoFactory" ["CoreClosedDayTypeGateway"]=> string(48) "Core\Factory\Gateway\ClosedDayTypeGatewayFactory" ["Core\Model\Services\CmsListManager"]=> string(42) "Core\Factory\Manager\CmsListManagerFactory" ["Core\Model\Dao\CmsListDao"]=> string(34) "Core\Factory\Dao\CmsListDaoFactory" ["CoreCmsListGateway"]=> string(42) "Core\Factory\Gateway\CmsListGatewayFactory" ["Core\Model\Services\CmsListItemManager"]=> string(46) "Core\Factory\Manager\CmsListItemManagerFactory" ["Core\Model\Dao\CmsListItemDao"]=> string(38) "Core\Factory\Dao\CmsListItemDaoFactory" ["CoreCmsListItemGateway"]=> string(46) "Core\Factory\Gateway\CmsListItemGatewayFactory" ["Core\Model\Services\ContentManager"]=> string(42) "Core\Factory\Manager\ContentManagerFactory" ["Core\Model\Dao\ContentDao"]=> string(34) "Core\Factory\Dao\ContentDaoFactory" ["CoreContentGateway"]=> string(42) "Core\Factory\Gateway\ContentGatewayFactory" ["CoreCmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["Core\Model\Services\CmsObjectTypeManager"]=> string(48) "Core\Factory\Manager\CmsObjectTypeManagerFactory" ["Core\Model\Dao\CmsObjectTypeDao"]=> string(40) "Core\Factory\Dao\CmsObjectTypeDaoFactory" ["CoreCmsObjectTypeGateway"]=> string(48) "Core\Factory\Gateway\CmsObjectTypeGatewayFactory" ["Core\Model\Services\CmsObjectPropertyManager"]=> string(52) "Core\Factory\Manager\CmsObjectPropertyManagerFactory" ["Core\Model\Dao\CmsObjectPropertyDao"]=> string(44) "Core\Factory\Dao\CmsObjectPropertyDaoFactory" ["CoreCmsObjectPropertyGateway"]=> string(52) "Core\Factory\Gateway\CmsObjectPropertyGatewayFactory" ["Core\Model\Services\CmsObjectPropertyTypeManager"]=> string(56) "Core\Factory\Manager\CmsObjectPropertyTypeManagerFactory" ["Core\Model\Dao\CmsObjectPropertyTypeDao"]=> string(48) "Core\Factory\Dao\CmsObjectPropertyTypeDaoFactory" ["CoreCmsObjectPropertyTypeGateway"]=> string(56) "Core\Factory\Gateway\CmsObjectPropertyTypeGatewayFactory" ["Core\Model\Services\ControllerActionManager"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDao"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["CoreControllerActionGateway"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\ControllerActionTemplateManager"]=> string(59) "Core\Factory\Manager\ControllerActionTemplateManagerFactory" ["Core\Model\Dao\ControllerActionTemplateDao"]=> string(51) "Core\Factory\Dao\ControllerActionTemplateDaoFactory" ["CoreControllerActionTemplateGateway"]=> string(59) "Core\Factory\Gateway\ControllerActionTemplateGatewayFactory" ["Core\Model\Services\CurrencyManager"]=> string(43) "Core\Factory\Manager\CurrencyManagerFactory" ["Core\Model\Dao\CurrencyDao"]=> string(35) "Core\Factory\Dao\CurrencyDaoFactory" ["CoreCurrencyGateway"]=> string(43) "Core\Factory\Gateway\CurrencyGatewayFactory" ["Core\Model\Services\CityManager"]=> string(39) "Core\Factory\Manager\CityManagerFactory" ["Core\Model\Dao\CityDao"]=> string(31) "Core\Factory\Dao\CityDaoFactory" ["CoreCityGateway"]=> string(39) "Core\Factory\Gateway\CityGatewayFactory" ["Core\Model\Services\CmsUserManager"]=> string(42) "Core\Factory\Manager\CmsUserManagerFactory" ["Core\Model\Dao\CmsUserDao"]=> string(34) "Core\Factory\Dao\CmsUserDaoFactory" ["CoreCmsUserGateway"]=> string(42) "Core\Factory\Gateway\CmsUserGatewayFactory" ["Core\Model\Services\ContinentManager"]=> string(44) "Core\Factory\Manager\ContinentManagerFactory" ["Core\Model\Dao\ContinentDao"]=> string(36) "Core\Factory\Dao\ContinentDaoFactory" ["CoreContinentGateway"]=> string(44) "Core\Factory\Gateway\ContinentGatewayFactory" ["Core\Model\Services\CountryManager"]=> string(42) "Core\Factory\Manager\CountryManagerFactory" ["Core\Model\Dao\CountryDao"]=> string(34) "Core\Factory\Dao\CountryDaoFactory" ["CoreCountryGateway"]=> string(42) "Core\Factory\Gateway\CountryGatewayFactory" ["Core\Model\Services\DebugIpManager"]=> string(42) "Core\Factory\Manager\DebugIpManagerFactory" ["Core\Model\Dao\DebugIpDao"]=> string(34) "Core\Factory\Dao\DebugIpDaoFactory" ["CoreDebugIpGateway"]=> string(42) "Core\Factory\Gateway\DebugIpGatewayFactory" ["Core\Model\Services\DeliveryTypeManager"]=> string(47) "Core\Factory\Manager\DeliveryTypeManagerFactory" ["Core\Model\Dao\DeliveryTypeDao"]=> string(39) "Core\Factory\Dao\DeliveryTypeDaoFactory" ["CoreDeliveryTypeGateway"]=> string(47) "Core\Factory\Gateway\DeliveryTypeGatewayFactory" ["Core\Model\Services\EmailManager"]=> string(40) "Core\Factory\Manager\EmailManagerFactory" ["Core\Model\Dao\EmailDao"]=> string(32) "Core\Factory\Dao\EmailDaoFactory" ["CoreEmailGateway"]=> string(40) "Core\Factory\Gateway\EmailGatewayFactory" ["Core\Model\Services\EmailMessageManager"]=> string(47) "Core\Factory\Manager\EmailMessageManagerFactory" ["Core\Model\Dao\EmailMessageDao"]=> string(39) "Core\Factory\Dao\EmailMessageDaoFactory" ["CoreEmailMessageGateway"]=> string(47) "Core\Factory\Gateway\EmailMessageGatewayFactory" ["Core\Model\Services\EmailTypeManager"]=> string(44) "Core\Factory\Manager\EmailTypeManagerFactory" ["Core\Model\Dao\EmailTypeDao"]=> string(36) "Core\Factory\Dao\EmailTypeDaoFactory" ["CoreEmailTypeGateway"]=> string(44) "Core\Factory\Gateway\EmailTypeGatewayFactory" ["Core\Model\Services\EntityRightManager"]=> string(46) "Core\Factory\Manager\EntityRightManagerFactory" ["Core\Model\Dao\EntityRightDao"]=> string(38) "Core\Factory\Dao\EntityRightDaoFactory" ["CoreEntityRightGateway"]=> string(46) "Core\Factory\Gateway\EntityRightGatewayFactory" ["Core\Model\Services\ExtranetUserManager"]=> string(47) "Core\Factory\Manager\ExtranetUserManagerFactory" ["Core\Model\Dao\ExtranetUserDao"]=> string(39) "Shop\Factory\Dao\ExtranetUserDaoFactory" ["CoreExtranetUserGateway"]=> string(47) "Core\Factory\Gateway\ExtranetUserGatewayFactory" ["Core\Model\Services\FormManager"]=> string(39) "Core\Factory\Manager\FormManagerFactory" ["Core\Model\Dao\FormDao"]=> string(31) "Core\Factory\Dao\FormDaoFactory" ["CoreFormGateway"]=> string(39) "Core\Factory\Gateway\FormGatewayFactory" ["Core\Model\Services\FormFieldsetManager"]=> string(47) "Core\Factory\Manager\FormFieldsetManagerFactory" ["Core\Model\Dao\FormFieldsetDao"]=> string(39) "Core\Factory\Dao\FormFieldsetDaoFactory" ["CoreFormFieldsetGateway"]=> string(47) "Core\Factory\Gateway\FormFieldsetGatewayFactory" ["Core\Model\Services\FormFieldManager"]=> string(44) "Core\Factory\Manager\FormFieldManagerFactory" ["Core\Model\Dao\FormFieldDao"]=> string(36) "Core\Factory\Dao\FormFieldDaoFactory" ["CoreFormFieldGateway"]=> string(44) "Core\Factory\Gateway\FormFieldGatewayFactory" ["Core\Model\Services\LanguageManager"]=> string(43) "Core\Factory\Manager\LanguageManagerFactory" ["Core\Model\Dao\LanguageDao"]=> string(35) "Core\Factory\Dao\LanguageDaoFactory" ["CoreLanguageGateway"]=> string(43) "Core\Factory\Gateway\LanguageGatewayFactory" ["Core\Model\Services\LibraryManager"]=> string(42) "Core\Factory\Manager\LibraryManagerFactory" ["Core\Model\Dao\LibraryDao"]=> string(34) "Core\Factory\Dao\LibraryDaoFactory" ["CoreLibraryGateway"]=> string(42) "Core\Factory\Gateway\LibraryGatewayFactory" ["Core\Model\Services\LibraryTypeManager"]=> string(46) "Core\Factory\Manager\LibraryTypeManagerFactory" ["Core\Model\Dao\LibraryTypeDao"]=> string(38) "Core\Factory\Dao\LibraryTypeDaoFactory" ["CoreLibraryTypeGateway"]=> string(46) "Core\Factory\Gateway\LibraryTypeGatewayFactory" ["Core\Model\Services\LibraryItemManager"]=> string(46) "Core\Factory\Manager\LibraryItemManagerFactory" ["Core\Model\Dao\LibraryItemDao"]=> string(38) "Core\Factory\Dao\LibraryItemDaoFactory" ["CoreLibraryItemGateway"]=> string(46) "Core\Factory\Gateway\LibraryItemGatewayFactory" ["Core\Model\Services\LibraryItemTypeManager"]=> string(50) "Core\Factory\Manager\LibraryItemTypeManagerFactory" ["Core\Model\Dao\LibraryItemTypeDao"]=> string(42) "Core\Factory\Dao\LibraryItemTypeDaoFactory" ["CoreLibraryItemTypeGateway"]=> string(50) "Core\Factory\Gateway\LibraryItemTypeGatewayFactory" ["Core\Model\Services\MessageManager"]=> string(42) "Core\Factory\Manager\MessageManagerFactory" ["Core\Model\Dao\MessageDao"]=> string(34) "Core\Factory\Dao\MessageDaoFactory" ["CoreMessageGateway"]=> string(42) "Core\Factory\Gateway\MessageGatewayFactory" ["Core\Model\Services\ModuleManager"]=> string(41) "Core\Factory\Manager\ModuleManagerFactory" ["Core\Model\Dao\ModuleDao"]=> string(33) "Core\Factory\Dao\ModuleDaoFactory" ["CoreModuleGateway"]=> string(41) "Core\Factory\Gateway\ModuleGatewayFactory" ["Core\Model\Services\ModuleParameterManager"]=> string(50) "Core\Factory\Manager\ModuleParameterManagerFactory" ["Core\Model\Dao\ModuleParameterDao"]=> string(42) "Core\Factory\Dao\ModuleParameterDaoFactory" ["CoreModuleParameterGateway"]=> string(50) "Core\Factory\Gateway\ModuleParameterGatewayFactory" ["Core\Model\Services\PageManager"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDao"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["CorePageGateway"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\PersonManager"]=> string(41) "Core\Factory\Manager\PersonManagerFactory" ["Core\Model\Dao\PersonDao"]=> string(33) "Core\Factory\Dao\PersonDaoFactory" ["CorePersonGateway"]=> string(41) "Core\Factory\Gateway\PersonGatewayFactory" ["Core\Model\Services\PersonRelationManager"]=> string(49) "Core\Factory\Manager\PersonRelationManagerFactory" ["Core\Model\Dao\PersonRelationDao"]=> string(41) "Core\Factory\Dao\PersonRelationDaoFactory" ["CorePersonRelationGateway"]=> string(49) "Core\Factory\Gateway\PersonRelationGatewayFactory" ["Core\Model\Services\PhoneManager"]=> string(40) "Core\Factory\Manager\PhoneManagerFactory" ["Core\Model\Dao\PhoneDao"]=> string(32) "Core\Factory\Dao\PhoneDaoFactory" ["CorePhoneGateway"]=> string(40) "Core\Factory\Gateway\PhoneGatewayFactory" ["Core\Model\Services\PhoneTypeManager"]=> string(44) "Core\Factory\Manager\PhoneTypeManagerFactory" ["Core\Model\Dao\PhoneTypeDao"]=> string(36) "Core\Factory\Dao\PhoneTypeDaoFactory" ["CorePhoneTypeGateway"]=> string(44) "Core\Factory\Gateway\PhoneTypeGatewayFactory" ["Core\Model\Services\RightManager"]=> string(40) "Core\Factory\Manager\RightManagerFactory" ["Core\Model\Dao\RightDao"]=> string(32) "Core\Factory\Dao\RightDaoFactory" ["CoreRightGateway"]=> string(40) "Core\Factory\Gateway\RightGatewayFactory" ["Core\Model\Services\RoleManager"]=> string(39) "Core\Factory\Manager\RoleManagerFactory" ["Core\Model\Dao\RoleDao"]=> string(31) "Core\Factory\Dao\RoleDaoFactory" ["CoreRoleGateway"]=> string(39) "Core\Factory\Gateway\RoleGatewayFactory" ["Core\Model\Services\RoleTypeManager"]=> string(43) "Core\Factory\Manager\RoleTypeManagerFactory" ["Core\Model\Dao\RoleTypeDao"]=> string(35) "Core\Factory\Dao\RoleTypeDaoFactory" ["CoreRoleTypeGateway"]=> string(43) "Core\Factory\Gateway\RoleTypeGatewayFactory" ["Core\Model\Services\RouteManager"]=> string(40) "Core\Factory\Manager\RouteManagerFactory" ["Core\Model\Dao\RouteDao"]=> string(32) "Core\Factory\Dao\RouteDaoFactory" ["CoreRouteGateway"]=> string(40) "Core\Factory\Gateway\RouteGatewayFactory" ["Core\Model\Services\ShortUrlManager"]=> string(43) "Core\Factory\Manager\ShortUrlManagerFactory" ["Core\Model\Dao\ShortUrlDao"]=> string(35) "Core\Factory\Dao\ShortUrlDaoFactory" ["CoreShortUrlGateway"]=> string(43) "Core\Factory\Gateway\ShortUrlGatewayFactory" ["Core\Model\Services\SiteManager"]=> string(39) "Core\Factory\Manager\SiteManagerFactory" ["Core\Model\Dao\SiteDao"]=> string(31) "Core\Factory\Dao\SiteDaoFactory" ["CoreSiteGateway"]=> string(39) "Core\Factory\Gateway\SiteGatewayFactory" ["Core\Model\Services\SiteDomainManager"]=> string(45) "Core\Factory\Manager\SiteDomainManagerFactory" ["Core\Model\Dao\SiteDomainDao"]=> string(37) "Core\Factory\Dao\SiteDomainDaoFactory" ["CoreSiteDomainGateway"]=> string(45) "Core\Factory\Gateway\SiteDomainGatewayFactory" ["Core\Model\Services\StateManager"]=> string(40) "Core\Factory\Manager\StateManagerFactory" ["Core\Model\Dao\StateDao"]=> string(32) "Core\Factory\Dao\StateDaoFactory" ["CoreStateGateway"]=> string(40) "Core\Factory\Gateway\StateGatewayFactory" ["Core\Model\Services\TemplateManager"]=> string(43) "Core\Factory\Manager\TemplateManagerFactory" ["Core\Model\Dao\TemplateDao"]=> string(35) "Core\Factory\Dao\TemplateDaoFactory" ["CoreTemplateGateway"]=> string(43) "Core\Factory\Gateway\TemplateGatewayFactory" ["Core\Model\Services\TemplateGroupManager"]=> string(48) "Core\Factory\Manager\TemplateGroupManagerFactory" ["Core\Model\Dao\TemplateGroupDao"]=> string(40) "Core\Factory\Dao\TemplateGroupDaoFactory" ["CoreTemplateGroupGateway"]=> string(48) "Core\Factory\Gateway\TemplateGroupGatewayFactory" ["Core\Model\Services\UserManager"]=> string(39) "Core\Factory\Manager\UserManagerFactory" ["Core\Model\Dao\UserDao"]=> string(31) "Core\Factory\Dao\UserDaoFactory" ["CoreUserGateway"]=> string(39) "Core\Factory\Gateway\UserGatewayFactory" ["Core\Model\Services\UserRoleManager"]=> string(43) "Core\Factory\Manager\UserRoleManagerFactory" ["Core\Model\Dao\UserRoleDao"]=> string(35) "Core\Factory\Dao\UserRoleDaoFactory" ["CoreUserRoleGateway"]=> string(43) "Core\Factory\Gateway\UserRoleGatewayFactory" ["Core\Model\Services\UserFavoritObjectManager"]=> string(52) "Core\Factory\Manager\UserFavoritObjectManagerFactory" ["Core\Model\Dao\UserFavoritObjectDao"]=> string(44) "Core\Factory\Dao\UserFavoritObjectDaoFactory" ["CoreUserFavoritObjectGateway"]=> string(52) "Core\Factory\Gateway\UserFavoritObjectGatewayFactory" ["Core\Model\Services\UserSessionManager"]=> string(46) "Core\Factory\Manager\UserSessionManagerFactory" ["Core\Model\Dao\UserSessionDao"]=> string(38) "Core\Factory\Dao\UserSessionDaoFactory" ["CoreUserSessionGateway"]=> string(46) "Core\Factory\Gateway\UserSessionGatewayFactory" ["Core\Model\Services\WebsiteManager"]=> string(42) "Core\Factory\Manager\WebsiteManagerFactory" ["Core\Model\Dao\WebsiteDao"]=> string(34) "Core\Factory\Dao\WebsiteDaoFactory" ["CoreWebsiteGateway"]=> string(42) "Core\Factory\Gateway\WebsiteGatewayFactory" ["Core\Model\Services\WebsiteTypeManager"]=> string(46) "Core\Factory\Manager\WebsiteTypeManagerFactory" ["Core\Model\Dao\WebsiteTypeDao"]=> string(38) "Core\Factory\Dao\WebsiteTypeDaoFactory" ["CoreWebsiteTypeGateway"]=> string(46) "Core\Factory\Gateway\WebsiteTypeGatewayFactory" ["CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyManager"]=> string(45) "Company\Factory\Manager\CompanyManagerFactory" ["Company\Model\Dao\CompanyDao"]=> string(37) "Company\Factory\Dao\CompanyDaoFactory" ["CompanyCompanyGateway"]=> string(45) "Company\Factory\Gateway\CompanyGatewayFactory" ["Company\Model\Services\DomainManager"]=> string(44) "Company\Factory\Manager\DomainManagerFactory" ["Company\Model\Dao\DomainDao"]=> string(36) "Company\Factory\Dao\DomainDaoFactory" ["CompanyDomainGateway"]=> string(44) "Company\Factory\Gateway\DomainGatewayFactory" ["Company\Model\Services\CompanyFunctionManager"]=> string(53) "Company\Factory\Manager\CompanyFunctionManagerFactory" ["Company\Model\Dao\CompanyFunctionDao"]=> string(45) "Company\Factory\Dao\CompanyFunctionDaoFactory" ["CompanyCompanyFunctionGateway"]=> string(53) "Company\Factory\Gateway\CompanyFunctionGatewayFactory" ["Company\Model\Services\EmployeeManager"]=> string(46) "Company\Factory\Manager\EmployeeManagerFactory" ["Company\Model\Dao\EmployeeDao"]=> string(38) "Company\Factory\Dao\EmployeeDaoFactory" ["CompanyEmployeeGateway"]=> string(46) "Company\Factory\Gateway\EmployeeGatewayFactory" ["Company\Model\Services\ContractManager"]=> string(46) "Company\Factory\Manager\ContractManagerFactory" ["Company\Model\Dao\ContractDao"]=> string(38) "Company\Factory\Dao\ContractDaoFactory" ["CompanyContractGateway"]=> string(46) "Company\Factory\Gateway\ContractGatewayFactory" ["Company\Model\Services\ContractTypeManager"]=> string(50) "Company\Factory\Manager\ContractTypeManagerFactory" ["Company\Model\Dao\ContractTypeDao"]=> string(42) "Company\Factory\Dao\ContractTypeDaoFactory" ["CompanyContractTypeGateway"]=> string(50) "Company\Factory\Gateway\ContractTypeGatewayFactory" ["StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["StructuredData\Model\Services\StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactManager"]=> string(45) "Contact\Factory\Manager\ContactManagerFactory" ["Contact\Model\Dao\ContactDao"]=> string(37) "Contact\Factory\Dao\ContactDaoFactory" ["ContactContactGateway"]=> string(45) "Contact\Factory\Gateway\ContactGatewayFactory" ["Contact\Model\Services\ContactAnswerManager"]=> string(51) "Contact\Factory\Manager\ContactAnswerManagerFactory" ["Contact\Model\Dao\ContactAnswerDao"]=> string(43) "Contact\Factory\Dao\ContactAnswerDaoFactory" ["ContactContactAnswerGateway"]=> string(51) "Contact\Factory\Gateway\ContactAnswerGatewayFactory" ["Contact\Model\Services\ContactCommentManager"]=> string(52) "Contact\Factory\Manager\ContactCommentManagerFactory" ["Contact\Model\Dao\ContactCommentDao"]=> string(44) "Contact\Factory\Dao\ContactCommentDaoFactory" ["ContactContactCommentGateway"]=> string(52) "Contact\Factory\Gateway\ContactCommentGatewayFactory" ["Contact\Model\Services\ContactStatusManager"]=> string(51) "Contact\Factory\Manager\ContactStatusManagerFactory" ["Contact\Model\Dao\ContactStatusDao"]=> string(43) "Contact\Factory\Dao\ContactStatusDaoFactory" ["ContactContactStatusGateway"]=> string(51) "Contact\Factory\Gateway\ContactStatusGatewayFactory" ["GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleryManager"]=> string(47) "Galleries\Factory\Manager\GalleryManagerFactory" ["Galleries\Model\Dao\GalleryDao"]=> string(39) "Galleries\Factory\Dao\GalleryDaoFactory" ["GalleriesGalleryGateway"]=> string(47) "Galleries\Factory\Gateway\GalleryGatewayFactory" ["Galleries\Model\Services\ItemManager"]=> string(44) "Galleries\Factory\Manager\ItemManagerFactory" ["Galleries\Model\Dao\ItemDao"]=> string(36) "Galleries\Factory\Dao\ItemDaoFactory" ["GalleriesItemGateway"]=> string(44) "Galleries\Factory\Gateway\ItemGatewayFactory" ["Galleries\Model\Services\ItemTypeManager"]=> string(48) "Galleries\Factory\Manager\ItemTypeManagerFactory" ["Galleries\Model\Dao\ItemTypeDao"]=> string(40) "Galleries\Factory\Dao\ItemTypeDaoFactory" ["GalleriesItemTypeGateway"]=> string(48) "Galleries\Factory\Gateway\ItemTypeGatewayFactory" ["Galleries\Model\Services\ItemCommentManager"]=> string(51) "Galleries\Factory\Manager\ItemCommentManagerFactory" ["Galleries\Model\Dao\ItemCommentDao"]=> string(43) "Galleries\Factory\Dao\ItemCommentDaoFactory" ["GalleriesItemCommentGateway"]=> string(51) "Galleries\Factory\Gateway\ItemCommentGatewayFactory" ["LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogManager"]=> string(38) "Logs\Factory\Manager\LogManagerFactory" ["Logs\Model\Dao\LogDao"]=> string(30) "Logs\Factory\Dao\LogDaoFactory" ["LogsLogGateway"]=> string(38) "Logs\Factory\Gateway\LogGatewayFactory" ["MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuManager"]=> string(39) "Menu\Factory\Manager\MenuManagerFactory" ["Menu\Model\Dao\MenuDao"]=> string(31) "Menu\Factory\Dao\MenuDaoFactory" ["MenuMenuGateway"]=> string(39) "Menu\Factory\Gateway\MenuGatewayFactory" ["Menu\Model\Services\MenuItemManager"]=> string(43) "Menu\Factory\Manager\MenuItemManagerFactory" ["Menu\Model\Dao\MenuItemDao"]=> string(35) "Menu\Factory\Dao\MenuItemDaoFactory" ["MenuMenuItemGateway"]=> string(43) "Menu\Factory\Gateway\MenuItemGatewayFactory" ["WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetManager"]=> string(43) "Widget\Factory\Manager\WidgetManagerFactory" ["Widget\Model\Dao\WidgetDao"]=> string(35) "Widget\Factory\Dao\WidgetDaoFactory" ["WidgetWidgetGateway"]=> string(43) "Widget\Factory\Gateway\WidgetGatewayFactory" ["Widget\Model\Services\WidgetPositionManager"]=> string(51) "Widget\Factory\Manager\WidgetPositionManagerFactory" ["Widget\Model\Dao\WidgetPositionDao"]=> string(43) "Widget\Factory\Dao\WidgetPositionDaoFactory" ["WidgetWidgetPositionGateway"]=> string(51) "Widget\Factory\Gateway\WidgetPositionGatewayFactory" ["ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductManager"]=> string(46) "Products\Factory\Manager\ProductManagerFactory" ["Products\Model\Dao\ProductDao"]=> string(38) "Products\Factory\Dao\ProductDaoFactory" ["ProductsProductGateway"]=> string(46) "Products\Factory\Gateway\ProductGatewayFactory" ["Products\Model\Services\CategoryManager"]=> string(47) "Products\Factory\Manager\CategoryManagerFactory" ["Products\Model\Dao\CategoryDao"]=> string(39) "Products\Factory\Dao\CategoryDaoFactory" ["ProductsCategoryGateway"]=> string(47) "Products\Factory\Gateway\CategoryGatewayFactory" ["Products\Model\Services\ProductTypeManager"]=> string(50) "Products\Factory\Manager\ProductTypeManagerFactory" ["Products\Model\Dao\ProductTypeDao"]=> string(42) "Products\Factory\Dao\ProductTypeDaoFactory" ["ProductsProductTypeGateway"]=> string(50) "Products\Factory\Gateway\ProductTypeGatewayFactory" ["Products\Model\Services\BrandManager"]=> string(44) "Products\Factory\Manager\BrandManagerFactory" ["Products\Model\Dao\BrandDao"]=> string(36) "Products\Factory\Dao\BrandDaoFactory" ["ProductsBrandGateway"]=> string(44) "Products\Factory\Gateway\BrandGatewayFactory" ["Products\Model\Services\CriteriaManager"]=> string(47) "Products\Factory\Manager\CriteriaManagerFactory" ["Products\Model\Dao\CriteriaDao"]=> string(39) "Products\Factory\Dao\CriteriaDaoFactory" ["ProductsCriteriaGateway"]=> string(47) "Products\Factory\Gateway\CriteriaGatewayFactory" ["ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopManager"]=> string(39) "Shop\Factory\Manager\ShopManagerFactory" ["Shop\Model\Dao\ShopDao"]=> string(31) "Shop\Factory\Dao\ShopDaoFactory" ["ShopShopGateway"]=> string(39) "Shop\Factory\Gateway\ShopGatewayFactory" ["Shop\Model\Services\ShopProductManager"]=> string(63) "Caveschateauauvernier\Factory\Manager\ShopProductManagerFactory" ["Shop\Model\Dao\ShopProductDao"]=> string(38) "Shop\Factory\Dao\ShopProductDaoFactory" ["ShopShopProductGateway"]=> string(46) "Shop\Factory\Gateway\ShopProductGatewayFactory" ["Shop\Model\Services\CategoryManager"]=> string(43) "Shop\Factory\Manager\CategoryManagerFactory" ["Shop\Model\Dao\CategoryDao"]=> string(35) "Shop\Factory\Dao\CategoryDaoFactory" ["ShopCategoryGateway"]=> string(43) "Shop\Factory\Gateway\CategoryGatewayFactory" ["Shop\Model\Services\OrderManager"]=> string(40) "Shop\Factory\Manager\OrderManagerFactory" ["Shop\Model\Dao\OrderDao"]=> string(32) "Shop\Factory\Dao\OrderDaoFactory" ["ShopOrderGateway"]=> string(40) "Shop\Factory\Gateway\OrderGatewayFactory" ["Shop\Model\Services\OrderItemManager"]=> string(44) "Shop\Factory\Manager\OrderItemManagerFactory" ["Shop\Model\Dao\OrderItemDao"]=> string(36) "Shop\Factory\Dao\OrderItemDaoFactory" ["ShopOrderItemGateway"]=> string(44) "Shop\Factory\Gateway\OrderItemGatewayFactory" ["Shop\Model\Services\TaxManager"]=> string(38) "Shop\Factory\Manager\TaxManagerFactory" ["Shop\Model\Dao\TaxDao"]=> string(30) "Shop\Factory\Dao\TaxDaoFactory" ["ShopTaxGateway"]=> string(38) "Shop\Factory\Gateway\TaxGatewayFactory" ["Shop\Model\Services\TaxGroupManager"]=> string(43) "Shop\Factory\Manager\TaxGroupManagerFactory" ["Shop\Model\Dao\TaxGroupDao"]=> string(35) "Shop\Factory\Dao\TaxGroupDaoFactory" ["ShopTaxGroupGateway"]=> string(43) "Shop\Factory\Gateway\TaxGroupGatewayFactory" ["Shop\Model\Services\TaxRuleManager"]=> string(42) "Shop\Factory\Manager\TaxRuleManagerFactory" ["Shop\Model\Dao\TaxRuleDao"]=> string(34) "Shop\Factory\Dao\TaxRuleDaoFactory" ["ShopTaxRuleGateway"]=> string(42) "Shop\Factory\Gateway\TaxRuleGatewayFactory" ["Shop\Model\Services\PriceTableManager"]=> string(45) "Shop\Factory\Manager\PriceTableManagerFactory" ["Shop\Model\Dao\PriceTableDao"]=> string(37) "Shop\Factory\Dao\PriceTableDaoFactory" ["ShopPriceTableGateway"]=> string(45) "Shop\Factory\Gateway\PriceTableGatewayFactory" ["Shop\Model\Services\PriceTableConditionnementManager"]=> string(60) "Shop\Factory\Manager\PriceTableConditionnementManagerFactory" ["Shop\Model\Dao\PriceTableConditionnementDao"]=> string(52) "Shop\Factory\Dao\PriceTableConditionnementDaoFactory" ["ShopPriceTableConditionnementGateway"]=> string(60) "Shop\Factory\Gateway\PriceTableConditionnementGatewayFactory" ["Shop\Model\Services\WishListManager"]=> string(43) "Shop\Factory\Manager\WishListManagerFactory" ["Shop\Model\Dao\WishListDao"]=> string(35) "Shop\Factory\Dao\WishListDaoFactory" ["ShopWishListGateway"]=> string(43) "Shop\Factory\Gateway\WishListGatewayFactory" ["Shop\Model\Services\PromotionManager"]=> string(44) "Shop\Factory\Manager\PromotionManagerFactory" ["Shop\Model\Dao\PromotionDao"]=> string(36) "Shop\Factory\Dao\PromotionDaoFactory" ["ShopPromotionGateway"]=> string(44) "Shop\Factory\Gateway\PromotionGatewayFactory" ["Shop\Model\Services\PromotionItemManager"]=> string(48) "Shop\Factory\Manager\PromotionItemManagerFactory" ["Shop\Model\Dao\PromotionItemDao"]=> string(40) "Shop\Factory\Dao\PromotionItemDaoFactory" ["ShopPromotionItemGateway"]=> string(48) "Shop\Factory\Gateway\PromotionItemGatewayFactory" ["Shop\Model\Services\CartManager"]=> string(39) "Shop\Factory\Manager\CartManagerFactory" ["Shop\Model\Dao\CartDao"]=> string(31) "Shop\Factory\Dao\CartDaoFactory" ["ShopCartGateway"]=> string(39) "Shop\Factory\Gateway\CartGatewayFactory" ["Shop\Model\Services\CartItemManager"]=> string(43) "Shop\Factory\Manager\CartItemManagerFactory" ["Shop\Model\Dao\CartItemDao"]=> string(35) "Shop\Factory\Dao\CartItemDaoFactory" ["ShopCartItemGateway"]=> string(43) "Shop\Factory\Gateway\CartItemGatewayFactory" ["Shop\Model\Services\CartConstraintManager"]=> string(49) "Shop\Factory\Manager\CartConstraintManagerFactory" ["Shop\Model\Dao\CartConstraintDao"]=> string(41) "Shop\Factory\Dao\CartConstraintDaoFactory" ["ShopCartConstraintGateway"]=> string(49) "Shop\Factory\Gateway\CartConstraintGatewayFactory" ["Shop\Model\Services\CartRuleManager"]=> string(43) "Shop\Factory\Manager\CartRuleManagerFactory" ["Shop\Model\Dao\CartRuleDao"]=> string(35) "Shop\Factory\Dao\CartRuleDaoFactory" ["ShopCartRuleGateway"]=> string(43) "Shop\Factory\Gateway\CartRuleGatewayFactory" ["Shop\Model\Services\CartRuleRestrictionManager"]=> string(54) "Shop\Factory\Manager\CartRuleRestrictionManagerFactory" ["Shop\Model\Dao\CartRuleRestrictionDao"]=> string(46) "Shop\Factory\Dao\CartRuleRestrictionDaoFactory" ["ShopCartRuleRestrictionGateway"]=> string(54) "Shop\Factory\Gateway\CartRuleRestrictionGatewayFactory" ["Shop\Model\Services\OrderCartRuleManager"]=> string(48) "Shop\Factory\Manager\OrderCartRuleManagerFactory" ["Shop\Model\Dao\OrderCartRuleDao"]=> string(40) "Shop\Factory\Dao\OrderCartRuleDaoFactory" ["ShopOrderCartRuleGateway"]=> string(48) "Shop\Factory\Gateway\OrderCartRuleGatewayFactory" ["Shop\Model\Services\OrderCartRuleRestrictionManager"]=> string(59) "Shop\Factory\Manager\OrderCartRuleRestrictionManagerFactory" ["Shop\Model\Dao\OrderCartRuleRestrictionDao"]=> string(51) "Shop\Factory\Dao\OrderCartRuleRestrictionDaoFactory" ["ShopOrderCartRuleRestrictionGateway"]=> string(59) "Shop\Factory\Gateway\OrderCartRuleRestrictionGatewayFactory" ["PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentManager"]=> string(46) "Payments\Factory\Manager\PaymentManagerFactory" ["Payments\Model\Dao\PaymentDao"]=> string(38) "Payments\Factory\Dao\PaymentDaoFactory" ["PaymentsPaymentGateway"]=> string(46) "Payments\Factory\Gateway\PaymentGatewayFactory" ["Payments\Model\Services\PaymentTypeManager"]=> string(50) "Payments\Factory\Manager\PaymentTypeManagerFactory" ["Payments\Model\Dao\PaymentTypeDao"]=> string(42) "Payments\Factory\Dao\PaymentTypeDaoFactory" ["PaymentsPaymentTypeGateway"]=> string(50) "Payments\Factory\Gateway\PaymentTypeGatewayFactory" ["TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialManager"]=> string(54) "Testimonials\Factory\Manager\TestimonialManagerFactory" ["Testimonials\Model\Dao\TestimonialDao"]=> string(46) "Testimonials\Factory\Dao\TestimonialDaoFactory" ["TestimonialsTestimonialGateway"]=> string(54) "Testimonials\Factory\Gateway\TestimonialGatewayFactory" ["ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopAnalytics\Model\Services\ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["ShopStructuredData\Model\Services\ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\PaymentManager"]=> string(46) "Checkout\Factory\Manager\PaymentManagerFactory" ["Checkout\Model\Services\API\WebHookUrlManager"]=> string(53) "Checkout\Factory\Manager\API\WebHookUrlManagerFactory" ["RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["Recaptcha\Model\Services\RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Caveschateauauvernier\Model\Services\CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Sentry\ClientInterface"]=> string(36) "SentryIO\Service\ClientConfigFactory" ["Sentry\State\HubInterface"]=> string(27) "SentryIO\Service\HubFactory" ["SentryIO\Listener\ErrorHandlerListener"]=> string(45) "SentryIO\Listener\ErrorHandlerListenerFactory" ["Laminas\Db\Adapter\Adapter"]=> string(40) "Laminas\Db\Adapter\AdapterServiceFactory" } ["delegators"]=> array(4) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> array(2) { [0]=> string(77) "Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory" [1]=> string(76) "Laminas\Cache\Storage\Adapter\BlackHole\AdapterPluginManagerDelegatorFactory" } ["HttpRouter"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["Laminas\Router\Http\TreeRouteStack"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["ViewHelperManager"]=> array(1) { [0]=> string(57) "Laminas\Navigation\View\ViewHelperManagerDelegatorFactory" } } ["aliases"]=> array(244) { ["Zend\Di\InjectorInterface"]=> string(28) "Laminas\Di\InjectorInterface" ["Zend\Di\ConfigInterface"]=> string(26) "Laminas\Di\ConfigInterface" ["Zend\Di\CodeGenerator\InjectorGenerator"]=> string(42) "Laminas\Di\CodeGenerator\InjectorGenerator" ["MvcTranslator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["Zend\Mvc\I18n\Translator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["InputFilterManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["Zend\InputFilter\InputFilterPluginManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["HttpRouter"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["router"]=> string(34) "Laminas\Router\RouteStackInterface" ["Router"]=> string(34) "Laminas\Router\RouteStackInterface" ["RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\Http\TreeRouteStack"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["Zend\Router\RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\RouteStackInterface"]=> string(34) "Laminas\Router\RouteStackInterface" ["Laminas\Form\Annotation\AnnotationBuilder"]=> string(21) "FormAnnotationBuilder" ["Laminas\Form\Annotation\AttributeBuilder"]=> string(20) "FormAttributeBuilder" ["Laminas\Form\FormElementManager"]=> string(18) "FormElementManager" ["ValidatorManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Validator\ValidatorPluginManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Mail\Protocol\SmtpPluginManager"]=> string(39) "Laminas\Mail\Protocol\SmtpPluginManager" ["TranslatorPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["Zend\I18n\Translator\TranslatorInterface"]=> string(43) "Laminas\I18n\Translator\TranslatorInterface" ["Zend\I18n\Translator\LoaderPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Zend\Navigation\Navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Core\Interfaces\AddressManagerInterface"]=> string(34) "Core\Model\Services\AddressManager" ["Core\Interfaces\AddressDaoInterface"]=> string(25) "Core\Model\Dao\AddressDao" ["Core\Interfaces\AddressTypeManagerInterface"]=> string(38) "Core\Model\Services\AddressTypeManager" ["Core\Interfaces\AddressTypeDaoInterface"]=> string(29) "Core\Model\Dao\AddressTypeDao" ["Core\Interfaces\AjaxRightManagerInterface"]=> string(36) "Core\Model\Services\AjaxRightManager" ["Core\Interfaces\AjaxRightDaoInterface"]=> string(27) "Core\Model\Dao\AjaxRightDao" ["Core\Interfaces\BankManagerInterface"]=> string(31) "Core\Model\Services\BankManager" ["Core\Interfaces\BankDaoInterface"]=> string(22) "Core\Model\Dao\BankDao" ["Core\Interfaces\BankAccountManagerInterface"]=> string(38) "Core\Model\Services\BankAccountManager" ["Core\Interfaces\BankAccountDaoInterface"]=> string(29) "Core\Model\Dao\BankAccountDao" ["Core\Interfaces\BankAddressManagerInterface"]=> string(38) "Core\Model\Services\BankAddressManager" ["Core\Interfaces\BankAddressDaoInterface"]=> string(29) "Core\Model\Dao\BankAddressDao" ["Core\Interfaces\CertificateManagerInterface"]=> string(38) "Core\Model\Services\CertificateManager" ["Core\Interfaces\CertificateDaoInterface"]=> string(29) "Core\Model\Dao\CertificateDao" ["Core\Interfaces\ClosedDayManagerInterface"]=> string(36) "Core\Model\Services\ClosedDayManager" ["Core\Interfaces\ClosedDayDaoInterface"]=> string(27) "Core\Model\Dao\ClosedDayDao" ["Core\Interfaces\ClosedDayTypeManagerInterface"]=> string(40) "Core\Model\Services\ClosedDayTypeManager" ["Core\Interfaces\ClosedDayTypeDaoInterface"]=> string(31) "Core\Model\Dao\ClosedDayTypeDao" ["Core\Interfaces\CmsListManagerInterface"]=> string(34) "Core\Model\Services\CmsListManager" ["Core\Interfaces\CmsListDaoInterface"]=> string(25) "Core\Model\Dao\CmsListDao" ["Core\Interfaces\CmsListItemManagerInterface"]=> string(38) "Core\Model\Services\CmsListItemManager" ["Core\Interfaces\CmsListItemDaoInterface"]=> string(29) "Core\Model\Dao\CmsListItemDao" ["Core\Interfaces\ContentManagerInterface"]=> string(34) "Core\Model\Services\ContentManager" ["Core\Interfaces\ContentDaoInterface"]=> string(25) "Core\Model\Dao\ContentDao" ["Core\Interfaces\CmsObjectManagerInterface"]=> string(36) "Core\Model\Services\CmsObjectManager" ["Core\Interfaces\CmsObjectDaoInterface"]=> string(27) "Core\Model\Dao\CmsObjectDao" ["Core\Interfaces\CmsObjectTypeManagerInterface"]=> string(40) "Core\Model\Services\CmsObjectTypeManager" ["Core\Interfaces\CmsObjectTypeDaoInterface"]=> string(31) "Core\Model\Dao\CmsObjectTypeDao" ["Core\Interfaces\CmsObjectPropertyManagerInterface"]=> string(44) "Core\Model\Services\CmsObjectPropertyManager" ["Core\Interfaces\CmsObjectPropertyDaoInterface"]=> string(35) "Core\Model\Dao\CmsObjectPropertyDao" ["Core\Interfaces\CmsObjectPropertyTypeManagerInterface"]=> string(48) "Core\Model\Services\CmsObjectPropertyTypeManager" ["Core\Interfaces\CmsObjectPropertyTypeDaoInterface"]=> string(39) "Core\Model\Dao\CmsObjectPropertyTypeDao" ["Core\Interfaces\CmsUserManagerInterface"]=> string(34) "Core\Model\Services\CmsUserManager" ["Core\Interfaces\CmsUserDaoInterface"]=> string(25) "Core\Model\Dao\CmsUserDao" ["Core\Interfaces\ControllerActionManagerInterface"]=> string(43) "Core\Model\Services\ControllerActionManager" ["Core\Interfaces\ControllerActionDaoInterface"]=> string(34) "Core\Model\Dao\ControllerActionDao" ["Core\Interfaces\ControllerActionTemplateManagerInterface"]=> string(51) "Core\Model\Services\ControllerActionTemplateManager" ["Core\Interfaces\ControllerActionTemplateDaoInterface"]=> string(42) "Core\Model\Dao\ControllerActionTemplateDao" ["Core\Interfaces\CurrencyManagerInterface"]=> string(35) "Core\Model\Services\CurrencyManager" ["Core\Interfaces\CurrencyDaoInterface"]=> string(26) "Core\Model\Dao\CurrencyDao" ["Core\Interfaces\CityManagerInterface"]=> string(31) "Core\Model\Services\CityManager" ["Core\Interfaces\CityDaoInterface"]=> string(22) "Core\Model\Dao\CityDao" ["Core\Interfaces\ContinentManagerInterface"]=> string(36) "Core\Model\Services\ContinentManager" ["Core\Interfaces\ContinentDaoInterface"]=> string(27) "Core\Model\Dao\ContinentDao" ["Core\Interfaces\CountryManagerInterface"]=> string(34) "Core\Model\Services\CountryManager" ["Core\Interfaces\CountryDaoInterface"]=> string(25) "Core\Model\Dao\CountryDao" ["Core\Interfaces\DebugIpManagerInterface"]=> string(34) "Core\Model\Services\DebugIpManager" ["Core\Interfaces\DebugIpDaoInterface"]=> string(25) "Core\Model\Dao\DebugIpDao" ["Core\Interfaces\DeliveryTypeManagerInterface"]=> string(39) "Core\Model\Services\DeliveryTypeManager" ["Core\Interfaces\DeliveryTypeDaoInterface"]=> string(30) "Core\Model\Dao\DeliveryTypeDao" ["Core\Interfaces\EmailManagerInterface"]=> string(32) "Core\Model\Services\EmailManager" ["Core\Interfaces\EmailDaoInterface"]=> string(23) "Core\Model\Dao\EmailDao" ["Core\Interfaces\EmailMessageManagerInterface"]=> string(39) "Core\Model\Services\EmailMessageManager" ["Core\Interfaces\EmailMessageDaoInterface"]=> string(30) "Core\Model\Dao\EmailMessageDao" ["Core\Interfaces\EmailTypeManagerInterface"]=> string(36) "Core\Model\Services\EmailTypeManager" ["Core\Interfaces\EmailTypeDaoInterface"]=> string(27) "Core\Model\Dao\EmailTypeDao" ["Core\Interfaces\EntityRightManagerInterface"]=> string(38) "Core\Model\Services\EntityRightManager" ["Core\Interfaces\EntityRightDaoInterface"]=> string(29) "Core\Model\Dao\EntityRightDao" ["Core\Interfaces\ExtranetUserManagerInterface"]=> string(39) "Core\Model\Services\ExtranetUserManager" ["Core\Interfaces\ExtranetUserDaoInterface"]=> string(30) "Core\Model\Dao\ExtranetUserDao" ["Core\Interfaces\FormManagerInterface"]=> string(31) "Core\Model\Services\FormManager" ["Core\Interfaces\FormDaoInterface"]=> string(22) "Core\Model\Dao\FormDao" ["Core\Interfaces\FormFieldsetManagerInterface"]=> string(39) "Core\Model\Services\FormFieldsetManager" ["Core\Interfaces\FormFieldsetDaoInterface"]=> string(30) "Core\Model\Dao\FormFieldsetDao" ["Core\Interfaces\FormFieldManagerInterface"]=> string(36) "Core\Model\Services\FormFieldManager" ["Core\Interfaces\FormFieldDaoInterface"]=> string(27) "Core\Model\Dao\FormFieldDao" ["Core\Interfaces\LanguageManagerInterface"]=> string(35) "Core\Model\Services\LanguageManager" ["Core\Interfaces\LanguageDaoInterface"]=> string(26) "Core\Model\Dao\LanguageDao" ["Core\Interfaces\LibraryManagerInterface"]=> string(34) "Core\Model\Services\LibraryManager" ["Core\Interfaces\LibraryDaoInterface"]=> string(25) "Core\Model\Dao\LibraryDao" ["Core\Interfaces\LibraryTypeManagerInterface"]=> string(38) "Core\Model\Services\LibraryTypeManager" ["Core\Interfaces\LibraryTypeDaoInterface"]=> string(29) "Core\Model\Dao\LibraryTypeDao" ["Core\Interfaces\LibraryItemManagerInterface"]=> string(38) "Core\Model\Services\LibraryItemManager" ["Core\Interfaces\LibraryItemDaoInterface"]=> string(29) "Core\Model\Dao\LibraryItemDao" ["Core\Interfaces\LibraryItemTypeManagerInterface"]=> string(42) "Core\Model\Services\LibraryItemTypeManager" ["Core\Interfaces\LibraryItemTypeDaoInterface"]=> string(33) "Core\Model\Dao\LibraryItemTypeDao" ["Core\Interfaces\MessageManagerInterface"]=> string(34) "Core\Model\Services\MessageManager" ["Core\Interfaces\MessageDaoInterface"]=> string(25) "Core\Model\Dao\MessageDao" ["Core\Interfaces\ModuleManagerInterface"]=> string(33) "Core\Model\Services\ModuleManager" ["Core\Interfaces\ModuleDaoInterface"]=> string(24) "Core\Model\Dao\ModuleDao" ["Core\Interfaces\ModuleParameterManagerInterface"]=> string(42) "Core\Model\Services\ModuleParameterManager" ["Core\Interfaces\ModuleParameterDaoInterface"]=> string(33) "Core\Model\Dao\ModuleParameterDao" ["Core\Interfaces\PageManagerInterface"]=> string(31) "Core\Model\Services\PageManager" ["Core\Interfaces\PageDaoInterface"]=> string(22) "Core\Model\Dao\PageDao" ["Core\Interfaces\PersonManagerInterface"]=> string(33) "Core\Model\Services\PersonManager" ["Core\Interfaces\PersonDaoInterface"]=> string(24) "Core\Model\Dao\PersonDao" ["Core\Interfaces\PersonRelationManagerInterface"]=> string(41) "Core\Model\Services\PersonRelationManager" ["Core\Interfaces\PersonRelationDaoInterface"]=> string(32) "Core\Model\Dao\PersonRelationDao" ["Core\Interfaces\PhoneManagerInterface"]=> string(32) "Core\Model\Services\PhoneManager" ["Core\Interfaces\PhoneDaoInterface"]=> string(23) "Core\Model\Dao\PhoneDao" ["Core\Interfaces\PhoneTypeManagerInterface"]=> string(36) "Core\Model\Services\PhoneTypeManager" ["Core\Interfaces\PhoneTypeDaoInterface"]=> string(27) "Core\Model\Dao\PhoneTypeDao" ["Core\Interfaces\RightManagerInterface"]=> string(32) "Core\Model\Services\RightManager" ["Core\Interfaces\RightDaoInterface"]=> string(23) "Core\Model\Dao\RightDao" ["Core\Interfaces\RoleManagerInterface"]=> string(31) "Core\Model\Services\RoleManager" ["Core\Interfaces\RoleDaoInterface"]=> string(22) "Core\Model\Dao\RoleDao" ["Core\Interfaces\RoleTypeManagerInterface"]=> string(35) "Core\Model\Services\RoleTypeManager" ["Core\Interfaces\RoleTypeDaoInterface"]=> string(26) "Core\Model\Dao\RoleTypeDao" ["Core\Interfaces\RouteManagerInterface"]=> string(32) "Core\Model\Services\RouteManager" ["Core\Interfaces\RouteDaoInterface"]=> string(23) "Core\Model\Dao\RouteDao" ["Core\Interfaces\ShortUrlManagerInterface"]=> string(35) "Core\Model\Services\ShortUrlManager" ["Core\Interfaces\ShortUrlDaoInterface"]=> string(26) "Core\Model\Dao\ShortUrlDao" ["Core\Interfaces\SiteManagerInterface"]=> string(31) "Core\Model\Services\SiteManager" ["Core\Interfaces\SiteDaoInterface"]=> string(22) "Core\Model\Dao\SiteDao" ["Core\Interfaces\SiteDomainManagerInterface"]=> string(37) "Core\Model\Services\SiteDomainManager" ["Core\Interfaces\SiteDomainDaoInterface"]=> string(28) "Core\Model\Dao\SiteDomainDao" ["Core\Interfaces\StateManagerInterface"]=> string(32) "Core\Model\Services\StateManager" ["Core\Interfaces\StateDaoInterface"]=> string(23) "Core\Model\Dao\StateDao" ["Core\Interfaces\TemplateManagerInterface"]=> string(35) "Core\Model\Services\TemplateManager" ["Core\Interfaces\TemplateDaoInterface"]=> string(26) "Core\Model\Dao\TemplateDao" ["Core\Interfaces\TemplateGroupManagerInterface"]=> string(40) "Core\Model\Services\TemplateGroupManager" ["Core\Interfaces\TemplateGroupDaoInterface"]=> string(31) "Core\Model\Dao\TemplateGroupDao" ["Core\Interfaces\UserManagerInterface"]=> string(31) "Core\Model\Services\UserManager" ["Core\Interfaces\UserDaoInterface"]=> string(22) "Core\Model\Dao\UserDao" ["Core\Interfaces\UserSessionManagerInterface"]=> string(38) "Core\Model\Services\UserSessionManager" ["Core\Interfaces\UserSessionDaoInterface"]=> string(29) "Core\Model\Dao\UserSessionDao" ["Core\Interfaces\UserRoleManagerInterface"]=> string(35) "Core\Model\Services\UserRoleManager" ["Core\Interfaces\UserRoleDaoInterface"]=> string(26) "Core\Model\Dao\UserRoleDao" ["Core\Interfaces\UserFavoritObjectManagerInterface"]=> string(44) "Core\Model\Services\UserFavoritObjectManager" ["Core\Interfaces\UserFavoritObjectDaoInterface"]=> string(35) "Core\Model\Dao\UserFavoritObjectDao" ["Core\Interfaces\WebsiteManagerInterface"]=> string(34) "Core\Model\Services\WebsiteManager" ["Core\Interfaces\WebsiteDaoInterface"]=> string(25) "Core\Model\Dao\WebsiteDao" ["Core\Interfaces\WebsiteTypeManagerInterface"]=> string(38) "Core\Model\Services\WebsiteTypeManager" ["Core\Interfaces\WebsiteTypeDaoInterface"]=> string(29) "Core\Model\Dao\WebsiteTypeDao" ["Company\Interfaces\CompanyManagerInterface"]=> string(37) "Company\Model\Services\CompanyManager" ["Company\Interfaces\CompanyDaoInterface"]=> string(28) "Company\Model\Dao\CompanyDao" ["Company\Interfaces\DomainManagerInterface"]=> string(36) "Company\Model\Services\DomainManager" ["Company\Interfaces\DomainDaoInterface"]=> string(27) "Company\Model\Dao\DomainDao" ["Company\Interfaces\CompanyFunctionManagerInterface"]=> string(45) "Company\Model\Services\CompanyFunctionManager" ["Company\Interfaces\CompanyFunctionDaoInterface"]=> string(36) "Company\Model\Dao\CompanyFunctionDao" ["Company\Interfaces\EmployeeManagerInterface"]=> string(38) "Company\Model\Services\EmployeeManager" ["Company\Interfaces\EmployeeDaoInterface"]=> string(29) "Company\Model\Dao\EmployeeDao" ["Company\Interfaces\ContractManagerInterface"]=> string(38) "Company\Model\Services\ContractManager" ["Company\Interfaces\ContractDaoInterface"]=> string(29) "Company\Model\Dao\ContractDao" ["Company\Interfaces\ContractTypeManagerInterface"]=> string(42) "Company\Model\Services\ContractTypeManager" ["Company\Interfaces\ContractTypeDaoInterface"]=> string(33) "Company\Model\Dao\ContractTypeDao" ["Contact\Interfaces\ContactManagerInterface"]=> string(37) "Contact\Model\Services\ContactManager" ["Contact\Interfaces\ContactDaoInterface"]=> string(28) "Contact\Model\Dao\ContactDao" ["Contact\Interfaces\ContactAnswerManagerInterface"]=> string(43) "Contact\Model\Services\ContactAnswerManager" ["Contact\Interfaces\ContactAnswerDaoInterface"]=> string(34) "Contact\Model\Dao\ContactAnswerDao" ["Contact\Interfaces\ContactCommentManagerInterface"]=> string(44) "Contact\Model\Services\ContactCommentManager" ["Contact\Interfaces\ContactCommentDaoInterface"]=> string(35) "Contact\Model\Dao\ContactCommentDao" ["Contact\Interfaces\ContactStatusManagerInterface"]=> string(43) "Contact\Model\Services\ContactStatusManager" ["Contact\Interfaces\ContactStatusDaoInterface"]=> string(34) "Contact\Model\Dao\ContactStatusDao" ["Galleries\Interfaces\GalleryManagerInterface"]=> string(39) "Galleries\Model\Services\GalleryManager" ["Galleries\Interfaces\GalleryDaoInterface"]=> string(30) "Galleries\Model\Dao\GalleryDao" ["Galleries\Interfaces\ItemManagerInterface"]=> string(36) "Galleries\Model\Services\ItemManager" ["Galleries\Interfaces\ItemDaoInterface"]=> string(27) "Galleries\Model\Dao\ItemDao" ["Galleries\Interfaces\ItemTypeManagerInterface"]=> string(40) "Galleries\Model\Services\ItemTypeManager" ["Galleries\Interfaces\ItemTypeDaoInterface"]=> string(31) "Galleries\Model\Dao\ItemTypeDao" ["Galleries\Interfaces\ItemCommentManagerInterface"]=> string(43) "Galleries\Model\Services\ItemCommentManager" ["Galleries\Interfaces\ItemCommentDaoInterface"]=> string(34) "Galleries\Model\Dao\ItemCommentDao" ["Logs\Interfaces\LogManagerInterface"]=> string(30) "Logs\Model\Services\LogManager" ["Logs\Interfaces\LogDaoInterface"]=> string(21) "Logs\Model\Dao\LogDao" ["Menu\Interfaces\MenuManagerInterface"]=> string(31) "Menu\Model\Services\MenuManager" ["Menu\Interfaces\MenuDaoInterface"]=> string(22) "Menu\Model\Dao\MenuDao" ["Menu\Interfaces\MenuItemManagerInterface"]=> string(35) "Menu\Model\Services\MenuItemManager" ["Menu\Interfaces\MenuItemDaoInterface"]=> string(26) "Menu\Model\Dao\MenuItemDao" ["Widget\Interfaces\WidgetManagerInterface"]=> string(35) "Widget\Model\Services\WidgetManager" ["Widget\Interfaces\WidgetDaoInterface"]=> string(26) "Widget\Model\Dao\WidgetDao" ["Widget\Interfaces\WidgetPositionManagerInterface"]=> string(43) "Widget\Model\Services\WidgetPositionManager" ["Widget\Interfaces\WidgetPositionDaoInterface"]=> string(34) "Widget\Model\Dao\WidgetPositionDao" ["Products\Interfaces\ProductManagerInterface"]=> string(38) "Products\Model\Services\ProductManager" ["Products\Interfaces\ProductDaoInterface"]=> string(29) "Products\Model\Dao\ProductDao" ["Products\Interfaces\CategoryManagerInterface"]=> string(39) "Products\Model\Services\CategoryManager" ["Products\Interfaces\CategoryDaoInterface"]=> string(30) "Products\Model\Dao\CategoryDao" ["Products\Interfaces\ProductTypeManagerInterface"]=> string(42) "Products\Model\Services\ProductTypeManager" ["Products\Interfaces\ProductTypeDaoInterface"]=> string(33) "Products\Model\Dao\ProductTypeDao" ["Products\Interfaces\BrandManagerInterface"]=> string(36) "Products\Model\Services\BrandManager" ["Products\Interfaces\BrandDaoInterface"]=> string(27) "Products\Model\Dao\BrandDao" ["Products\Interfaces\CriteriaManagerInterface"]=> string(39) "Products\Model\Services\CriteriaManager" ["Products\Interfaces\CriteriaDaoInterface"]=> string(30) "Products\Model\Dao\CriteriaDao" ["Shop\Interfaces\ShopManagerInterface"]=> string(31) "Shop\Model\Services\ShopManager" ["Shop\Interfaces\ShopDaoInterface"]=> string(22) "Shop\Model\Dao\ShopDao" ["Shop\Interfaces\ShopProductManagerInterface"]=> string(38) "Shop\Model\Services\ShopProductManager" ["Shop\Interfaces\ShopProductDaoInterface"]=> string(29) "Shop\Model\Dao\ShopProductDao" ["Shop\Interfaces\CategoryManagerInterface"]=> string(35) "Shop\Model\Services\CategoryManager" ["Shop\Interfaces\CategoryDaoInterface"]=> string(26) "Shop\Model\Dao\CategoryDao" ["Shop\Interfaces\OrderManagerInterface"]=> string(32) "Shop\Model\Services\OrderManager" ["Shop\Interfaces\OrderDaoInterface"]=> string(23) "Shop\Model\Dao\OrderDao" ["Shop\Interfaces\OrderItemManagerInterface"]=> string(36) "Shop\Model\Services\OrderItemManager" ["Shop\Interfaces\OrderItemDaoInterface"]=> string(27) "Shop\Model\Dao\OrderItemDao" ["Shop\Interfaces\TaxManagerInterface"]=> string(30) "Shop\Model\Services\TaxManager" ["Shop\Interfaces\TaxDaoInterface"]=> string(21) "Shop\Model\Dao\TaxDao" ["Shop\Interfaces\TaxGroupManagerInterface"]=> string(35) "Shop\Model\Services\TaxGroupManager" ["Shop\Interfaces\TaxGroupDaoInterface"]=> string(26) "Shop\Model\Dao\TaxGroupDao" ["Shop\Interfaces\TaxRuleManagerInterface"]=> string(34) "Shop\Model\Services\TaxRuleManager" ["Shop\Interfaces\TaxRuleDaoInterface"]=> string(25) "Shop\Model\Dao\TaxRuleDao" ["Shop\Interfaces\PriceTableManagerInterface"]=> string(37) "Shop\Model\Services\PriceTableManager" ["Shop\Interfaces\PriceTableDaoInterface"]=> string(28) "Shop\Model\Dao\PriceTableDao" ["Shop\Interfaces\PriceTableConditionnementManagerInterface"]=> string(52) "Shop\Model\Services\PriceTableConditionnementManager" ["Shop\Interfaces\PriceTableConditionnementDaoInterface"]=> string(43) "Shop\Model\Dao\PriceTableConditionnementDao" ["Shop\Interfaces\WishListManagerInterface"]=> string(35) "Shop\Model\Services\WishListManager" ["Shop\Interfaces\WishListDaoInterface"]=> string(26) "Shop\Model\Dao\WishListDao" ["Shop\Interfaces\PromotionManagerInterface"]=> string(36) "Shop\Model\Services\PromotionManager" ["Shop\Interfaces\PromotionDaoInterface"]=> string(27) "Shop\Model\Dao\PromotionDao" ["Shop\Interfaces\PromotionItemManagerInterface"]=> string(40) "Shop\Model\Services\PromotionItemManager" ["Shop\Interfaces\PromotionItemDaoInterface"]=> string(31) "Shop\Model\Dao\PromotionItemDao" ["Shop\Interfaces\CartManagerInterface"]=> string(31) "Shop\Model\Services\CartManager" ["Shop\Interfaces\CartDaoInterface"]=> string(22) "Shop\Model\Dao\CartDao" ["Shop\Interfaces\CartItemManagerInterface"]=> string(35) "Shop\Model\Services\CartItemManager" ["Shop\Interfaces\CartItemDaoInterface"]=> string(26) "Shop\Model\Dao\CartItemDao" ["Shop\Interfaces\CartConstraintManagerInterface"]=> string(41) "Shop\Model\Services\CartConstraintManager" ["Shop\Interfaces\CartConstraintDaoInterface"]=> string(32) "Shop\Model\Dao\CartConstraintDao" ["Shop\Interfaces\CartRuleManagerInterface"]=> string(35) "Shop\Model\Services\CartRuleManager" ["Shop\Interfaces\CartRuleDaoInterface"]=> string(26) "Shop\Model\Dao\CartRuleDao" ["Shop\Interfaces\CartRuleRestrictionManagerInterface"]=> string(46) "Shop\Model\Services\CartRuleRestrictionManager" ["Shop\Interfaces\CartRuleRestrictionDaoInterface"]=> string(37) "Shop\Model\Dao\CartRuleRestrictionDao" ["Shop\Interfaces\OrderCartRuleManagerInterface"]=> string(40) "Shop\Model\Services\OrderCartRuleManager" ["Shop\Interfaces\OrderCartRuleDaoInterface"]=> string(31) "Shop\Model\Dao\OrderCartRuleDao" ["Shop\Interfaces\OrderCartRuleRestrictionManagerInterface"]=> string(51) "Shop\Model\Services\OrderCartRuleRestrictionManager" ["Shop\Interfaces\OrderCartRuleRestrictionDaoInterface"]=> string(42) "Shop\Model\Dao\OrderCartRuleRestrictionDao" ["Payments\Interfaces\PaymentManagerInterface"]=> string(38) "Payments\Model\Services\PaymentManager" ["Payments\Interfaces\PaymentDaoInterface"]=> string(29) "Payments\Model\Dao\PaymentDao" ["Payments\Interfaces\PaymentTypeManagerInterface"]=> string(42) "Payments\Model\Services\PaymentTypeManager" ["Payments\Interfaces\PaymentTypeDaoInterface"]=> string(33) "Payments\Model\Dao\PaymentTypeDao" ["Testimonials\Interfaces\TestimonialManagerInterface"]=> string(46) "Testimonials\Model\Services\TestimonialManager" ["Testimonials\Interfaces\TestimonialDaoInterface"]=> string(37) "Testimonials\Model\Dao\TestimonialDao" ["Checkout\Interfaces\PaymentManagerInterface"]=> string(38) "Checkout\Model\Services\PaymentManager" } } ["laminas-cli"]=> array(0) { } ["controller_plugins"]=> array(2) { ["aliases"]=> array(25) { ["identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Laminas\Mvc\Controller\Plugin\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["Zend\Mvc\Controller\Plugin\Identity"]=> string(38) "Laminas\Mvc\Controller\Plugin\Identity" ["Zend\Mvc\Plugin\Identity\Identity"]=> string(36) "Laminas\Mvc\Plugin\Identity\Identity" ["fileprg"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["filepostredirectget"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Laminas\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["Zend\Mvc\Controller\Plugin\FilePostRedirectGet"]=> string(49) "Laminas\Mvc\Controller\Plugin\FilePostRedirectGet" ["Zend\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(46) "Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet" ["prg"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["postredirectget"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Laminas\Mvc\Controller\Plugin\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["Zend\Mvc\Controller\Plugin\PostRedirectGet"]=> string(45) "Laminas\Mvc\Controller\Plugin\PostRedirectGet" ["Zend\Mvc\Plugin\Prg\PostRedirectGet"]=> string(38) "Laminas\Mvc\Plugin\Prg\PostRedirectGet" ["flashmessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["flashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Laminas\Mvc\Controller\Plugin\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" ["Zend\Mvc\Controller\Plugin\FlashMessenger"]=> string(44) "Laminas\Mvc\Controller\Plugin\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(48) "Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger" } ["factories"]=> array(4) { ["Laminas\Mvc\Plugin\Identity\Identity"]=> string(43) "Laminas\Mvc\Plugin\Identity\IdentityFactory" ["Laminas\Mvc\Plugin\FilePrg\FilePostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\Prg\PostRedirectGet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\FlashMessenger"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["input_filters"]=> array(1) { ["abstract_factories"]=> array(1) { [0]=> string(53) "Laminas\InputFilter\InputFilterAbstractServiceFactory" } } ["route_manager"]=> array(0) { } ["router"]=> array(1) { ["routes"]=> array(14) { ["home"]=> array(2) { ["type"]=> string(27) "Laminas\Router\Http\Literal" ["options"]=> array(2) { ["route"]=> string(1) "/" ["defaults"]=> array(2) { ["controller"]=> string(20) "Core\Controller\Core" ["action"]=> string(5) "index" } } } ["core.cron.xmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontasks/xmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(10) "xmlsitemap" } } } ["core.cron.mlxmlsitemap"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(23) "/crontasks/mlxmlsitemap" ["defaults"]=> array(2) { ["controller"]=> string(35) "Core\Controller\SiteAdminController" ["action"]=> string(12) "mlxmlsitemap" } } } ["core.form.checkunique"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/check-unique-ajax" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "checkunique" } } } ["core.empty"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(21) "/crontask/executeonce" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(11) "executeonce" } } } ["core.crypt.smtppass"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(25) "/bwt_tools/crypt/smtppass" ["defaults"]=> array(2) { ["controller"]=> string(33) "Core\Controller\UtilityController" ["action"]=> string(13) "cryptsmtppass" } } } ["core.account.activation.email"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(22) "/user/activation/email" ["defaults"]=> array(2) { ["controller"]=> string(30) "Core\Controller\CoreController" ["action"]=> string(32) "resenduseraccountactivationemail" } } } ["search.cron.indexation"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(27) "/crontasks/searchindexation" ["defaults"]=> array(2) { ["controller"]=> string(28) "Search\Controller\IndexAdmin" ["action"]=> string(12) "rebuildindex" } } } ["search.search"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(12) "/search-ajax" ["defaults"]=> array(2) { ["controller"]=> string(24) "Search\Controller\Search" ["action"]=> string(10) "searchajax" } } } ["shop.order.tocart"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/shop/order/tocart" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(11) "ordertocart" } } } ["shop.order.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.en.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/en/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["shop.order.fr.pdf"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(18) "/fr/shop/order/pdf" ["defaults"]=> array(2) { ["controller"]=> string(31) "Shop\Controller\OrderController" ["action"]=> string(8) "pdforder" } } } ["checkout.hook.backurl"]=> array(2) { ["type"]=> string(7) "Segment" ["options"]=> array(2) { ["route"]=> string(15) "/checkout/bkurl" ["defaults"]=> array(2) { ["controller"]=> string(37) "Checkout\Controller\PaymentController" ["action"]=> string(7) "backurl" } } } } } ["view_helpers"]=> array(2) { ["aliases"]=> array(222) { ["form"]=> string(29) "Laminas\Form\View\Helper\Form" ["Form"]=> string(29) "Laminas\Form\View\Helper\Form" ["formbutton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["form_button"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["FormButton"]=> string(35) "Laminas\Form\View\Helper\FormButton" ["formcaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["form_captcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["formCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["FormCaptcha"]=> string(36) "Laminas\Form\View\Helper\FormCaptcha" ["captchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captcha/dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["CaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formcaptchadumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["form_captcha_dumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["formCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["FormCaptchaDumb"]=> string(37) "Laminas\Form\View\Helper\Captcha\Dumb" ["captchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha/figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["CaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formcaptchafiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["form_captcha_figlet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["formCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["FormCaptchaFiglet"]=> string(39) "Laminas\Form\View\Helper\Captcha\Figlet" ["captchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha/image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["CaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formcaptchaimage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["form_captcha_image"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["formCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["FormCaptchaImage"]=> string(38) "Laminas\Form\View\Helper\Captcha\Image" ["captcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha/recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["captchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["CaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcaptcharecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["form_captcha_recaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["FormCaptchaRecaptcha"]=> string(42) "Laminas\Form\View\Helper\Captcha\ReCaptcha" ["formcheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["form_checkbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["FormCheckbox"]=> string(37) "Laminas\Form\View\Helper\FormCheckbox" ["formcollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["form_collection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["FormCollection"]=> string(39) "Laminas\Form\View\Helper\FormCollection" ["formcolor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["form_color"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["FormColor"]=> string(34) "Laminas\Form\View\Helper\FormColor" ["formdate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["form_date"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["FormDate"]=> string(33) "Laminas\Form\View\Helper\FormDate" ["formdatetime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["form_date_time"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["FormDateTime"]=> string(37) "Laminas\Form\View\Helper\FormDateTime" ["formdatetimelocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["form_date_time_local"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["FormDateTimeLocal"]=> string(42) "Laminas\Form\View\Helper\FormDateTimeLocal" ["formdatetimeselect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["form_date_time_select"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["FormDateTimeSelect"]=> string(43) "Laminas\Form\View\Helper\FormDateTimeSelect" ["formdateselect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_date_select"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["formDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["FormDateSelect"]=> string(39) "Laminas\Form\View\Helper\FormDateSelect" ["form_element"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formelement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["formElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["FormElement"]=> string(36) "Laminas\Form\View\Helper\FormElement" ["form_element_errors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formelementerrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["formElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["FormElementErrors"]=> string(42) "Laminas\Form\View\Helper\FormElementErrors" ["form_email"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formemail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["formEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["FormEmail"]=> string(34) "Laminas\Form\View\Helper\FormEmail" ["form_file"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["FormFile"]=> string(33) "Laminas\Form\View\Helper\FormFile" ["formfileapcprogress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["form_file_apc_progress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["FormFileApcProgress"]=> string(49) "Laminas\Form\View\Helper\File\FormFileApcProgress" ["formfilesessionprogress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["form_file_session_progress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["FormFileSessionProgress"]=> string(53) "Laminas\Form\View\Helper\File\FormFileSessionProgress" ["formfileuploadprogress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["form_file_upload_progress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["FormFileUploadProgress"]=> string(52) "Laminas\Form\View\Helper\File\FormFileUploadProgress" ["formhidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["form_hidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["FormHidden"]=> string(35) "Laminas\Form\View\Helper\FormHidden" ["formimage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["form_image"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["formImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["FormImage"]=> string(34) "Laminas\Form\View\Helper\FormImage" ["forminput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["form_input"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["FormInput"]=> string(34) "Laminas\Form\View\Helper\FormInput" ["formlabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["form_label"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["FormLabel"]=> string(34) "Laminas\Form\View\Helper\FormLabel" ["formmonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["form_month"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["FormMonth"]=> string(34) "Laminas\Form\View\Helper\FormMonth" ["formmonthselect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["form_month_select"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["FormMonthSelect"]=> string(40) "Laminas\Form\View\Helper\FormMonthSelect" ["formmulticheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["form_multi_checkbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["FormMultiCheckbox"]=> string(42) "Laminas\Form\View\Helper\FormMultiCheckbox" ["formnumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["form_number"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["FormNumber"]=> string(35) "Laminas\Form\View\Helper\FormNumber" ["formpassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["form_password"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["FormPassword"]=> string(37) "Laminas\Form\View\Helper\FormPassword" ["formradio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["form_radio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["FormRadio"]=> string(34) "Laminas\Form\View\Helper\FormRadio" ["formrange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["form_range"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["FormRange"]=> string(34) "Laminas\Form\View\Helper\FormRange" ["formreset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["form_reset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["FormReset"]=> string(34) "Laminas\Form\View\Helper\FormReset" ["formrow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["form_row"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["FormRow"]=> string(32) "Laminas\Form\View\Helper\FormRow" ["formsearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["form_search"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["FormSearch"]=> string(35) "Laminas\Form\View\Helper\FormSearch" ["formselect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["form_select"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["FormSelect"]=> string(35) "Laminas\Form\View\Helper\FormSelect" ["formsubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["form_submit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["FormSubmit"]=> string(35) "Laminas\Form\View\Helper\FormSubmit" ["formtel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["form_tel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["FormTel"]=> string(32) "Laminas\Form\View\Helper\FormTel" ["formtext"]=> string(33) "Laminas\Form\View\Helper\FormText" ["form_text"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["FormText"]=> string(33) "Laminas\Form\View\Helper\FormText" ["formtextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["form_text_area"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextarea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["FormTextArea"]=> string(37) "Laminas\Form\View\Helper\FormTextarea" ["formtime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["form_time"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["FormTime"]=> string(33) "Laminas\Form\View\Helper\FormTime" ["formurl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["form_url"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["FormUrl"]=> string(32) "Laminas\Form\View\Helper\FormUrl" ["formweek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["form_week"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["formWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["FormWeek"]=> string(33) "Laminas\Form\View\Helper\FormWeek" ["flashmessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["flashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["Zend\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(60) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger" ["zendviewhelperflashmessenger"]=> string(31) "laminasviewhelperflashmessenger" ["currencyformat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["currencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["dateformat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["dateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["numberformat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["numberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["translateplural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["translatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" ["Zend\I18n\View\Helper\CurrencyFormat"]=> string(39) "Laminas\I18n\View\Helper\CurrencyFormat" ["Zend\I18n\View\Helper\DateFormat"]=> string(35) "Laminas\I18n\View\Helper\DateFormat" ["Zend\I18n\View\Helper\NumberFormat"]=> string(37) "Laminas\I18n\View\Helper\NumberFormat" ["Zend\I18n\View\Helper\Plural"]=> string(31) "Laminas\I18n\View\Helper\Plural" ["Zend\I18n\View\Helper\Translate"]=> string(34) "Laminas\I18n\View\Helper\Translate" ["Zend\I18n\View\Helper\TranslatePlural"]=> string(40) "Laminas\I18n\View\Helper\TranslatePlural" } ["factories"]=> array(52) { ["Laminas\Form\View\Helper\Form"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormButton"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Dumb"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Figlet"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\Image"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\Captcha\ReCaptcha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormCollection"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormColor"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeLocal"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateTimeSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormDateSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElement"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormElementErrors"]=> string(57) "Laminas\Form\View\Helper\Factory\FormElementErrorsFactory" ["Laminas\Form\View\Helper\FormEmail"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormFile"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileApcProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileSessionProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\File\FormFileUploadProgress"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormHidden"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormImage"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormInput"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormLabel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonth"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMonthSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormMultiCheckbox"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormPassword"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRadio"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRange"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormReset"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormRow"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSearch"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSelect"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormSubmit"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTel"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormText"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTextarea"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormUrl"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Form\View\Helper\FormWeek"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["laminasviewhelperflashmessenger"]=> string(67) "Laminas\Mvc\Plugin\FlashMessenger\View\Helper\FlashMessengerFactory" ["Laminas\I18n\View\Helper\CurrencyFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\DateFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Plural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\Translate"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\View\Helper\TranslatePlural"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["filters"]=> array(2) { ["aliases"]=> array(14) { ["alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["numberformat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["numberparse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["numberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" ["Zend\I18n\Filter\Alnum"]=> string(25) "Laminas\I18n\Filter\Alnum" ["Zend\I18n\Filter\Alpha"]=> string(25) "Laminas\I18n\Filter\Alpha" ["Zend\I18n\Filter\NumberFormat"]=> string(32) "Laminas\I18n\Filter\NumberFormat" ["Zend\I18n\Filter\NumberParse"]=> string(31) "Laminas\I18n\Filter\NumberParse" } ["factories"]=> array(4) { ["Laminas\I18n\Filter\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberFormat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Filter\NumberParse"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["validators"]=> array(2) { ["aliases"]=> array(30) { ["alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["datetime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["dateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Float"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Int"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isfloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["isint"]=> string(28) "Laminas\I18n\Validator\IsInt" ["isInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["phonenumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["phoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["postcode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["postCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" ["Zend\I18n\Validator\Alnum"]=> string(28) "Laminas\I18n\Validator\Alnum" ["Zend\I18n\Validator\Alpha"]=> string(28) "Laminas\I18n\Validator\Alpha" ["Zend\I18n\Validator\DateTime"]=> string(31) "Laminas\I18n\Validator\DateTime" ["Zend\I18n\Validator\IsFloat"]=> string(30) "Laminas\I18n\Validator\IsFloat" ["Zend\I18n\Validator\IsInt"]=> string(28) "Laminas\I18n\Validator\IsInt" ["Zend\I18n\Validator\PhoneNumber"]=> string(34) "Laminas\I18n\Validator\PhoneNumber" ["Zend\I18n\Validator\PostCode"]=> string(31) "Laminas\I18n\Validator\PostCode" } ["factories"]=> array(7) { ["Laminas\I18n\Validator\Alnum"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\Alpha"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\DateTime"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsFloat"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\IsInt"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PhoneNumber"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" ["Laminas\I18n\Validator\PostCode"]=> string(47) "Laminas\ServiceManager\Factory\InvokableFactory" } } ["controllers"]=> array(2) { ["factories"]=> array(232) { ["Core\Controller\CoreController"]=> string(45) "Core\Factory\Controller\CoreControllerFactory" ["Core\Controller\AdminController"]=> string(46) "Core\Factory\Controller\AdminControllerFactory" ["Core\Controller\AddressController"]=> string(48) "Core\Factory\Controller\AddressControllerFactory" ["Core\Controller\AddressAdminController"]=> string(53) "Core\Factory\Controller\AddressAdminControllerFactory" ["Core\Controller\AddressTypeController"]=> string(52) "Core\Factory\Controller\AddressTypeControllerFactory" ["Core\Controller\AddressTypeAdminController"]=> string(57) "Core\Factory\Controller\AddressTypeAdminControllerFactory" ["Core\Controller\AjaxRightController"]=> string(50) "Core\Factory\Controller\AjaxRightControllerFactory" ["Core\Controller\AjaxRightAdminController"]=> string(55) "Core\Factory\Controller\AjaxRightAdminControllerFactory" ["Core\Controller\BankController"]=> string(45) "Core\Factory\Controller\BankControllerFactory" ["Core\Controller\BankAdminController"]=> string(50) "Core\Factory\Controller\BankAdminControllerFactory" ["Core\Controller\BankAccountController"]=> string(52) "Core\Factory\Controller\BankAccountControllerFactory" ["Core\Controller\BankAccountAdminController"]=> string(57) "Core\Factory\Controller\BankAccountAdminControllerFactory" ["Core\Controller\BankAddressController"]=> string(52) "Core\Factory\Controller\BankAddressControllerFactory" ["Core\Controller\BankAddressAdminController"]=> string(57) "Core\Factory\Controller\BankAddressAdminControllerFactory" ["Core\Controller\CertificateController"]=> string(52) "Core\Factory\Controller\CertificateControllerFactory" ["Core\Controller\CertificateAdminController"]=> string(57) "Core\Factory\Controller\CertificateAdminControllerFactory" ["Core\Controller\ClosedDayController"]=> string(50) "Core\Factory\Controller\ClosedDayControllerFactory" ["Core\Controller\ClosedDayAdminController"]=> string(55) "Core\Factory\Controller\ClosedDayAdminControllerFactory" ["Core\Controller\ClosedDayTypeController"]=> string(54) "Core\Factory\Controller\ClosedDayTypeControllerFactory" ["Core\Controller\ClosedDayTypeAdminController"]=> string(59) "Core\Factory\Controller\ClosedDayTypeAdminControllerFactory" ["Core\Controller\CmsListController"]=> string(48) "Core\Factory\Controller\CmsListControllerFactory" ["Core\Controller\CmsListAdminController"]=> string(53) "Core\Factory\Controller\CmsListAdminControllerFactory" ["Core\Controller\CmsListItemController"]=> string(52) "Core\Factory\Controller\CmsListItemControllerFactory" ["Core\Controller\CmsListItemAdminController"]=> string(57) "Core\Factory\Controller\CmsListItemAdminControllerFactory" ["Core\Controller\ContentController"]=> string(48) "Core\Factory\Controller\ContentControllerFactory" ["Core\Controller\ContentAdminController"]=> string(53) "Core\Factory\Controller\ContentAdminControllerFactory" ["Core\Controller\CmsObjectController"]=> string(50) "Core\Factory\Controller\CmsObjectControllerFactory" ["Core\Controller\CmsObjectAdminController"]=> string(55) "Core\Factory\Controller\CmsObjectAdminControllerFactory" ["Core\Controller\CmsObjectTypeController"]=> string(54) "Core\Factory\Controller\CmsObjectTypeControllerFactory" ["Core\Controller\CmsObjectTypeAdminController"]=> string(59) "Core\Factory\Controller\CmsObjectTypeAdminControllerFactory" ["Core\Controller\CmsObjectPropertyController"]=> string(58) "Core\Factory\Controller\CmsObjectPropertyControllerFactory" ["Core\Controller\CmsObjectPropertyAdminController"]=> string(63) "Core\Factory\Controller\CmsObjectPropertyAdminControllerFactory" ["Core\Controller\CmsObjectPropertyTypeController"]=> string(62) "Core\Factory\Controller\CmsObjectPropertyTypeControllerFactory" ["Core\Controller\CmsObjectPropertyTypeAdminController"]=> string(67) "Core\Factory\Controller\CmsObjectPropertyTypeAdminControllerFactory" ["Core\Controller\CmsUserController"]=> string(48) "Core\Factory\Controller\CmsUserControllerFactory" ["Core\Controller\CmsUserAdminController"]=> string(53) "Core\Factory\Controller\CmsUserAdminControllerFactory" ["Core\Controller\ControllerActionController"]=> string(57) "Core\Factory\Controller\ControllerActionControllerFactory" ["Core\Controller\ControllerActionAdminController"]=> string(62) "Core\Factory\Controller\ControllerActionAdminControllerFactory" ["Core\Controller\ControllerActionTemplateController"]=> string(65) "Core\Factory\Controller\ControllerActionTemplateControllerFactory" ["Core\Controller\ControllerActionTemplateAdminController"]=> string(70) "Core\Factory\Controller\ControllerActionTemplateAdminControllerFactory" ["Core\Controller\CurrencyController"]=> string(49) "Core\Factory\Controller\CurrencyControllerFactory" ["Core\Controller\CurrencyAdminController"]=> string(54) "Core\Factory\Controller\CurrencyAdminControllerFactory" ["Core\Controller\CityController"]=> string(45) "Core\Factory\Controller\CityControllerFactory" ["Core\Controller\CityAdminController"]=> string(50) "Core\Factory\Controller\CityAdminControllerFactory" ["Core\Controller\ContinentController"]=> string(50) "Core\Factory\Controller\ContinentControllerFactory" ["Core\Controller\ContinentAdminController"]=> string(55) "Core\Factory\Controller\ContinentAdminControllerFactory" ["Core\Controller\CountryController"]=> string(48) "Core\Factory\Controller\CountryControllerFactory" ["Core\Controller\CountryAdminController"]=> string(53) "Core\Factory\Controller\CountryAdminControllerFactory" ["Core\Controller\DebugIpController"]=> string(48) "Core\Factory\Controller\DebugIpControllerFactory" ["Core\Controller\DebugIpAdminController"]=> string(53) "Core\Factory\Controller\DebugIpAdminControllerFactory" ["Core\Controller\DeliveryTypeController"]=> string(53) "Core\Factory\Controller\DeliveryTypeControllerFactory" ["Core\Controller\DeliveryTypeAdminController"]=> string(58) "Core\Factory\Controller\DeliveryTypeAdminControllerFactory" ["Core\Controller\EmailController"]=> string(46) "Core\Factory\Controller\EmailControllerFactory" ["Core\Controller\EmailAdminController"]=> string(51) "Core\Factory\Controller\EmailAdminControllerFactory" ["Core\Controller\EmailTypeController"]=> string(50) "Core\Factory\Controller\EmailTypeControllerFactory" ["Core\Controller\EmailTypeAdminController"]=> string(55) "Core\Factory\Controller\EmailTypeAdminControllerFactory" ["Core\Controller\EntityRightController"]=> string(52) "Core\Factory\Controller\EntityRightControllerFactory" ["Core\Controller\EntityRightAdminController"]=> string(57) "Core\Factory\Controller\EntityRightAdminControllerFactory" ["Core\Controller\ExtranetUserController"]=> string(53) "Core\Factory\Controller\ExtranetUserControllerFactory" ["Core\Controller\ExtranetUserAdminController"]=> string(58) "Core\Factory\Controller\ExtranetUserAdminControllerFactory" ["Core\Controller\FormController"]=> string(45) "Core\Factory\Controller\FormControllerFactory" ["Core\Controller\FormAdminController"]=> string(50) "Core\Factory\Controller\FormAdminControllerFactory" ["Core\Controller\FormFieldsetController"]=> string(53) "Core\Factory\Controller\FormFieldsetControllerFactory" ["Core\Controller\FormFieldsetAdminController"]=> string(58) "Core\Factory\Controller\FormFieldsetAdminControllerFactory" ["Core\Controller\FormFieldController"]=> string(50) "Core\Factory\Controller\FormFieldControllerFactory" ["Core\Controller\FormFieldAdminController"]=> string(55) "Core\Factory\Controller\FormFieldAdminControllerFactory" ["Core\Controller\LanguageController"]=> string(49) "Core\Factory\Controller\LanguageControllerFactory" ["Core\Controller\LanguageAdminController"]=> string(54) "Core\Factory\Controller\LanguageAdminControllerFactory" ["Core\Controller\LibraryController"]=> string(48) "Core\Factory\Controller\LibraryControllerFactory" ["Core\Controller\LibraryAdminController"]=> string(53) "Core\Factory\Controller\LibraryAdminControllerFactory" ["Core\Controller\LibraryTypeController"]=> string(52) "Core\Factory\Controller\LibraryTypeControllerFactory" ["Core\Controller\LibraryTypeAdminController"]=> string(57) "Core\Factory\Controller\LibraryTypeAdminControllerFactory" ["Core\Controller\LibraryItemController"]=> string(52) "Core\Factory\Controller\LibraryItemControllerFactory" ["Core\Controller\LibraryItemAdminController"]=> string(57) "Core\Factory\Controller\LibraryItemAdminControllerFactory" ["Core\Controller\LibraryItemTypeController"]=> string(56) "Core\Factory\Controller\LibraryItemTypeControllerFactory" ["Core\Controller\LibraryItemTypeAdminController"]=> string(61) "Core\Factory\Controller\LibraryItemTypeAdminControllerFactory" ["Core\Controller\MessageController"]=> string(48) "Core\Factory\Controller\MessageControllerFactory" ["Core\Controller\MessageAdminController"]=> string(53) "Core\Factory\Controller\MessageAdminControllerFactory" ["Core\Controller\ModuleController"]=> string(47) "Core\Factory\Controller\ModuleControllerFactory" ["Core\Controller\ModuleAdminController"]=> string(52) "Core\Factory\Controller\ModuleAdminControllerFactory" ["Core\Controller\ModuleParameterController"]=> string(56) "Core\Factory\Controller\ModuleParameterControllerFactory" ["Core\Controller\ModuleParameterAdminController"]=> string(61) "Core\Factory\Controller\ModuleParameterAdminControllerFactory" ["Core\Controller\PageController"]=> string(45) "Core\Factory\Controller\PageControllerFactory" ["Core\Controller\PageAdminController"]=> string(50) "Core\Factory\Controller\PageAdminControllerFactory" ["Core\Controller\PersonController"]=> string(47) "Core\Factory\Controller\PersonControllerFactory" ["Core\Controller\PersonAdminController"]=> string(52) "Core\Factory\Controller\PersonAdminControllerFactory" ["Core\Controller\PersonRelationController"]=> string(55) "Core\Factory\Controller\PersonRelationControllerFactory" ["Core\Controller\PersonRelationAdminController"]=> string(60) "Core\Factory\Controller\PersonRelationAdminControllerFactory" ["Core\Controller\PhoneController"]=> string(46) "Core\Factory\Controller\PhoneControllerFactory" ["Core\Controller\PhoneAdminController"]=> string(51) "Core\Factory\Controller\PhoneAdminControllerFactory" ["Core\Controller\PhoneTypeController"]=> string(50) "Core\Factory\Controller\PhoneTypeControllerFactory" ["Core\Controller\PhoneTypeAdminController"]=> string(55) "Core\Factory\Controller\PhoneTypeAdminControllerFactory" ["Core\Controller\RightController"]=> string(46) "Core\Factory\Controller\RightControllerFactory" ["Core\Controller\RightAdminController"]=> string(51) "Core\Factory\Controller\RightAdminControllerFactory" ["Core\Controller\RoleController"]=> string(45) "Core\Factory\Controller\RoleControllerFactory" ["Core\Controller\RoleAdminController"]=> string(50) "Core\Factory\Controller\RoleAdminControllerFactory" ["Core\Controller\RoleTypeController"]=> string(49) "Core\Factory\Controller\RoleTypeControllerFactory" ["Core\Controller\RoleTypeAdminController"]=> string(54) "Core\Factory\Controller\RoleTypeAdminControllerFactory" ["Core\Controller\RouteController"]=> string(46) "Core\Factory\Controller\RouteControllerFactory" ["Core\Controller\RouteAdminController"]=> string(51) "Core\Factory\Controller\RouteAdminControllerFactory" ["Core\Controller\ShortUrlController"]=> string(49) "Core\Factory\Controller\ShortUrlControllerFactory" ["Core\Controller\ShortUrlAdminController"]=> string(54) "Core\Factory\Controller\ShortUrlAdminControllerFactory" ["Core\Controller\SiteController"]=> string(45) "Core\Factory\Controller\SiteControllerFactory" ["Core\Controller\SiteAdminController"]=> string(50) "Core\Factory\Controller\SiteAdminControllerFactory" ["Core\Controller\SiteDomainController"]=> string(51) "Core\Factory\Controller\SiteDomainControllerFactory" ["Core\Controller\SiteDomainAdminController"]=> string(56) "Core\Factory\Controller\SiteDomainAdminControllerFactory" ["Core\Controller\StateController"]=> string(46) "Core\Factory\Controller\StateControllerFactory" ["Core\Controller\StateAdminController"]=> string(51) "Core\Factory\Controller\StateAdminControllerFactory" ["Core\Controller\TemplateController"]=> string(49) "Core\Factory\Controller\TemplateControllerFactory" ["Core\Controller\TemplateAdminController"]=> string(54) "Core\Factory\Controller\TemplateAdminControllerFactory" ["Core\Controller\TemplateGroupController"]=> string(54) "Core\Factory\Controller\TemplateGroupControllerFactory" ["Core\Controller\TemplateGroupAdminController"]=> string(59) "Core\Factory\Controller\TemplateGroupAdminControllerFactory" ["Core\Controller\UserController"]=> string(45) "Core\Factory\Controller\UserControllerFactory" ["Core\Controller\UserAdminController"]=> string(50) "Core\Factory\Controller\UserAdminControllerFactory" ["Core\Controller\UserFavoritObjectController"]=> string(58) "Core\Factory\Controller\UserFavoritObjectControllerFactory" ["Core\Controller\UserFavoritObjectAdminController"]=> string(63) "Core\Factory\Controller\UserFavoritObjectAdminControllerFactory" ["Core\Controller\UserRoleController"]=> string(49) "Core\Factory\Controller\UserRoleControllerFactory" ["Core\Controller\UserRoleAdminController"]=> string(54) "Core\Factory\Controller\UserRoleAdminControllerFactory" ["Core\Controller\UserSessionController"]=> string(52) "Core\Factory\Controller\UserSessionControllerFactory" ["Core\Controller\UserSessionAdminController"]=> string(57) "Core\Factory\Controller\UserSessionAdminControllerFactory" ["Core\Controller\UtilityController"]=> string(48) "Core\Factory\Controller\UtilityControllerFactory" ["Core\Controller\WebsiteController"]=> string(48) "Core\Factory\Controller\WebsiteControllerFactory" ["Core\Controller\WebsiteAdminController"]=> string(53) "Core\Factory\Controller\WebsiteAdminControllerFactory" ["Core\Controller\WebsiteTypeController"]=> string(52) "Core\Factory\Controller\WebsiteTypeControllerFactory" ["Core\Controller\WebsiteTypeAdminController"]=> string(57) "Core\Factory\Controller\WebsiteTypeAdminControllerFactory" ["Company\Controller\CompanyModuleController"]=> string(57) "Company\Factory\Controller\CompanyModuleControllerFactory" ["Company\Controller\CompanyController"]=> string(51) "Company\Factory\Controller\CompanyControllerFactory" ["Company\Controller\CompanyAdminController"]=> string(56) "Company\Factory\Controller\CompanyAdminControllerFactory" ["Company\Controller\DomainController"]=> string(50) "Company\Factory\Controller\DomainControllerFactory" ["Company\Controller\DomainAdminController"]=> string(55) "Company\Factory\Controller\DomainAdminControllerFactory" ["Company\Controller\CompanyFunctionController"]=> string(59) "Company\Factory\Controller\CompanyFunctionControllerFactory" ["Company\Controller\CompanyFunctionAdminController"]=> string(64) "Company\Factory\Controller\CompanyFunctionAdminControllerFactory" ["Company\Controller\EmployeeController"]=> string(52) "Company\Factory\Controller\EmployeeControllerFactory" ["Company\Controller\EmployeeAdminController"]=> string(57) "Company\Factory\Controller\EmployeeAdminControllerFactory" ["Company\Controller\ContractController"]=> string(52) "Company\Factory\Controller\ContractControllerFactory" ["Company\Controller\ContractAdminController"]=> string(57) "Company\Factory\Controller\ContractAdminControllerFactory" ["Company\Controller\ContractTypeController"]=> string(56) "Company\Factory\Controller\ContractTypeControllerFactory" ["Company\Controller\ContractTypeAdminController"]=> string(61) "Company\Factory\Controller\ContractTypeAdminControllerFactory" ["Contact\Controller\ContactModuleController"]=> string(57) "Contact\Factory\Controller\ContactModuleControllerFactory" ["Contact\Controller\ContactController"]=> string(51) "Contact\Factory\Controller\ContactControllerFactory" ["Contact\Controller\ContactAdminController"]=> string(56) "Contact\Factory\Controller\ContactAdminControllerFactory" ["Contact\Controller\ContactAnswerController"]=> string(57) "Contact\Factory\Controller\ContactAnswerControllerFactory" ["Contact\Controller\ContactAnswerAdminController"]=> string(62) "Contact\Factory\Controller\ContactAnswerAdminControllerFactory" ["Contact\Controller\ContactCommentController"]=> string(58) "Contact\Factory\Controller\ContactCommentControllerFactory" ["Contact\Controller\ContactCommentAdminController"]=> string(63) "Contact\Factory\Controller\ContactCommentAdminControllerFactory" ["Contact\Controller\ContactStatusController"]=> string(57) "Contact\Factory\Controller\ContactStatusControllerFactory" ["Contact\Controller\ContactStatusAdminController"]=> string(62) "Contact\Factory\Controller\ContactStatusAdminControllerFactory" ["Galleries\Controller\GalleriesModuleController"]=> string(61) "Galleries\Factory\Controller\GalleriesModuleControllerFactory" ["Galleries\Controller\GalleryController"]=> string(53) "Galleries\Factory\Controller\GalleryControllerFactory" ["Galleries\Controller\GalleryAdminController"]=> string(58) "Galleries\Factory\Controller\GalleryAdminControllerFactory" ["Galleries\Controller\ItemController"]=> string(50) "Galleries\Factory\Controller\ItemControllerFactory" ["Galleries\Controller\ItemAdminController"]=> string(55) "Galleries\Factory\Controller\ItemAdminControllerFactory" ["Galleries\Controller\ItemTypeController"]=> string(54) "Galleries\Factory\Controller\ItemTypeControllerFactory" ["Galleries\Controller\ItemTypeAdminController"]=> string(59) "Galleries\Factory\Controller\ItemTypeAdminControllerFactory" ["Galleries\Controller\ItemCommentController"]=> string(57) "Galleries\Factory\Controller\ItemCommentControllerFactory" ["Galleries\Controller\ItemCommentAdminController"]=> string(62) "Galleries\Factory\Controller\ItemCommentAdminControllerFactory" ["Logs\Controller\LogsModuleController"]=> string(51) "Logs\Factory\Controller\LogsModuleControllerFactory" ["Logs\Controller\LogController"]=> string(44) "Logs\Factory\Controller\LogControllerFactory" ["Logs\Controller\LogAdminController"]=> string(49) "Logs\Factory\Controller\LogAdminControllerFactory" ["Menu\Controller\MenuModuleController"]=> string(51) "Menu\Factory\Controller\MenuModuleControllerFactory" ["Menu\Controller\MenuController"]=> string(45) "Menu\Factory\Controller\MenuControllerFactory" ["Menu\Controller\MenuAdminController"]=> string(50) "Menu\Factory\Controller\MenuAdminControllerFactory" ["Menu\Controller\MenuItemController"]=> string(49) "Menu\Factory\Controller\MenuItemControllerFactory" ["Menu\Controller\MenuItemAdminController"]=> string(54) "Menu\Factory\Controller\MenuItemAdminControllerFactory" ["Widget\Controller\WidgetModuleController"]=> string(55) "Widget\Factory\Controller\WidgetModuleControllerFactory" ["Widget\Controller\WidgetController"]=> string(49) "Widget\Factory\Controller\WidgetControllerFactory" ["Widget\Controller\WidgetAdminController"]=> string(54) "Widget\Factory\Controller\WidgetAdminControllerFactory" ["Widget\Controller\WidgetPositionController"]=> string(57) "Widget\Factory\Controller\WidgetPositionControllerFactory" ["Widget\Controller\WidgetPositionAdminController"]=> string(62) "Widget\Factory\Controller\WidgetPositionAdminControllerFactory" ["Search\Controller\SearchController"]=> string(49) "Search\Factory\Controller\SearchControllerFactory" ["Products\Controller\ProductsModuleController"]=> string(59) "Products\Factory\Controller\ProductsModuleControllerFactory" ["Products\Controller\ProductController"]=> string(52) "Products\Factory\Controller\ProductControllerFactory" ["Products\Controller\ProductAdminController"]=> string(57) "Products\Factory\Controller\ProductAdminControllerFactory" ["Products\Controller\CategoryController"]=> string(53) "Products\Factory\Controller\CategoryControllerFactory" ["Products\Controller\CategoryAdminController"]=> string(58) "Products\Factory\Controller\CategoryAdminControllerFactory" ["Products\Controller\ProductTypeController"]=> string(56) "Products\Factory\Controller\ProductTypeControllerFactory" ["Products\Controller\ProductTypeAdminController"]=> string(61) "Products\Factory\Controller\ProductTypeAdminControllerFactory" ["Products\Controller\BrandController"]=> string(50) "Products\Factory\Controller\BrandControllerFactory" ["Products\Controller\BrandAdminController"]=> string(55) "Products\Factory\Controller\BrandAdminControllerFactory" ["Products\Controller\CriteriaController"]=> string(53) "Products\Factory\Controller\CriteriaControllerFactory" ["Products\Controller\CriteriaAdminController"]=> string(58) "Products\Factory\Controller\CriteriaAdminControllerFactory" ["Shop\Controller\ShopModuleController"]=> string(51) "Shop\Factory\Controller\ShopModuleControllerFactory" ["Shop\Controller\ShopController"]=> string(45) "Shop\Factory\Controller\ShopControllerFactory" ["Shop\Controller\ShopAdminController"]=> string(50) "Shop\Factory\Controller\ShopAdminControllerFactory" ["Shop\Controller\ShopProductController"]=> string(52) "Shop\Factory\Controller\ShopProductControllerFactory" ["Shop\Controller\ShopProductAdminController"]=> string(57) "Shop\Factory\Controller\ShopProductAdminControllerFactory" ["Shop\Controller\CategoryController"]=> string(49) "Shop\Factory\Controller\CategoryControllerFactory" ["Shop\Controller\CategoryAdminController"]=> string(54) "Shop\Factory\Controller\CategoryAdminControllerFactory" ["Shop\Controller\OrderController"]=> string(46) "Shop\Factory\Controller\OrderControllerFactory" ["Shop\Controller\OrderAdminController"]=> string(51) "Shop\Factory\Controller\OrderAdminControllerFactory" ["Shop\Controller\OrderItemController"]=> string(50) "Shop\Factory\Controller\OrderItemControllerFactory" ["Shop\Controller\OrderItemAdminController"]=> string(55) "Shop\Factory\Controller\OrderItemAdminControllerFactory" ["Shop\Controller\TaxController"]=> string(44) "Shop\Factory\Controller\TaxControllerFactory" ["Shop\Controller\TaxAdminController"]=> string(49) "Shop\Factory\Controller\TaxAdminControllerFactory" ["Shop\Controller\TaxGroupController"]=> string(49) "Shop\Factory\Controller\TaxGroupControllerFactory" ["Shop\Controller\TaxGroupAdminController"]=> string(54) "Shop\Factory\Controller\TaxGroupAdminControllerFactory" ["Shop\Controller\TaxRuleController"]=> string(48) "Shop\Factory\Controller\TaxRuleControllerFactory" ["Shop\Controller\TaxRuleAdminController"]=> string(53) "Shop\Factory\Controller\TaxRuleAdminControllerFactory" ["Shop\Controller\PriceTableController"]=> string(51) "Shop\Factory\Controller\PriceTableControllerFactory" ["Shop\Controller\PriceTableAdminController"]=> string(56) "Shop\Factory\Controller\PriceTableAdminControllerFactory" ["Shop\Controller\PriceTableConditionnementController"]=> string(66) "Shop\Factory\Controller\PriceTableConditionnementControllerFactory" ["Shop\Controller\PriceTableConditionnementAdminController"]=> string(71) "Shop\Factory\Controller\PriceTableConditionnementAdminControllerFactory" ["Shop\Controller\WishListController"]=> string(49) "Shop\Factory\Controller\WishListControllerFactory" ["Shop\Controller\WishListAdminController"]=> string(54) "Shop\Factory\Controller\WishListAdminControllerFactory" ["Shop\Controller\PromotionController"]=> string(50) "Shop\Factory\Controller\PromotionControllerFactory" ["Shop\Controller\PromotionAdminController"]=> string(55) "Shop\Factory\Controller\PromotionAdminControllerFactory" ["Shop\Controller\PromotionItemController"]=> string(54) "Shop\Factory\Controller\PromotionItemControllerFactory" ["Shop\Controller\PromotionItemAdminController"]=> string(59) "Shop\Factory\Controller\PromotionItemAdminControllerFactory" ["Shop\Controller\CartController"]=> string(45) "Shop\Factory\Controller\CartControllerFactory" ["Shop\Controller\CartAdminController"]=> string(50) "Shop\Factory\Controller\CartAdminControllerFactory" ["Shop\Controller\CartItemController"]=> string(49) "Shop\Factory\Controller\CartItemControllerFactory" ["Shop\Controller\CartItemAdminController"]=> string(54) "Shop\Factory\Controller\CartItemAdminControllerFactory" ["Shop\Controller\CartConstraintController"]=> string(55) "Shop\Factory\Controller\CartConstraintControllerFactory" ["Shop\Controller\CartConstraintAdminController"]=> string(60) "Shop\Factory\Controller\CartConstraintAdminControllerFactory" ["Shop\Controller\CartRuleController"]=> string(49) "Shop\Factory\Controller\CartRuleControllerFactory" ["Shop\Controller\CartRuleAdminController"]=> string(54) "Shop\Factory\Controller\CartRuleAdminControllerFactory" ["Shop\Controller\CartRuleRestrictionController"]=> string(60) "Shop\Factory\Controller\CartRuleRestrictionControllerFactory" ["Shop\Controller\CartRuleRestrictionAdminController"]=> string(65) "Shop\Factory\Controller\CartRuleRestrictionAdminControllerFactory" ["Shop\Controller\OrderCartRuleController"]=> string(54) "Shop\Factory\Controller\OrderCartRuleControllerFactory" ["Shop\Controller\OrderCartRuleAdminController"]=> string(59) "Shop\Factory\Controller\OrderCartRuleAdminControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionController"]=> string(65) "Shop\Factory\Controller\OrderCartRuleRestrictionControllerFactory" ["Shop\Controller\OrderCartRuleRestrictionAdminController"]=> string(70) "Shop\Factory\Controller\OrderCartRuleRestrictionAdminControllerFactory" ["ShopWinBiz\Controller\WinBizController"]=> string(53) "ShopWinBiz\Factory\Controller\WinBizControllerFactory" ["Payments\Controller\PaymentsModuleController"]=> string(59) "Payments\Factory\Controller\PaymentsModuleControllerFactory" ["Payments\Controller\PaymentController"]=> string(52) "Payments\Factory\Controller\PaymentControllerFactory" ["Payments\Controller\PaymentAdminController"]=> string(57) "Payments\Factory\Controller\PaymentAdminControllerFactory" ["Payments\Controller\PaymentTypeController"]=> string(56) "Payments\Factory\Controller\PaymentTypeControllerFactory" ["Payments\Controller\PaymentTypeAdminController"]=> string(61) "Payments\Factory\Controller\PaymentTypeAdminControllerFactory" ["Testimonials\Controller\TestimonialsModuleController"]=> string(67) "Testimonials\Factory\Controller\TestimonialsModuleControllerFactory" ["Testimonials\Controller\TestimonialController"]=> string(60) "Testimonials\Factory\Controller\TestimonialControllerFactory" ["Testimonials\Controller\TestimonialAdminController"]=> string(65) "Testimonials\Factory\Controller\TestimonialAdminControllerFactory" ["Checkout\Controller\PaymentController"]=> string(52) "Checkout\Factory\Controller\PaymentControllerFactory" } ["invokables"]=> array(45) { ["MyFirstPlugin"]=> string(36) "Core\Controller\Plugin\MyFirstPlugin" ["Core\Controller\Core"]=> string(30) "Core\Controller\CoreController" ["Core\Controller\LibraryAdmin"]=> string(38) "Core\Controller\LibraryAdminController" ["Core\Controller\Debug"]=> string(31) "Core\Controller\DebugController" ["Core\Controller\Desktop"]=> string(33) "Core\Controller\DesktopController" ["Core\Controller\Diploma"]=> string(38) "Core\Controller\DiplomaAdminController" ["Core\Controller\UnitTest\CoreUnitTest"]=> string(47) "Core\Controller\UnitTest\CoreUnitTestController" ["Core\Controller\UnitTest\CoreAddressUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreAddressUnitTestController" ["Core\Controller\UnitTest\CoreAddressTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreAddressTypeUnitTestController" ["Core\Controller\UnitTest\CoreAjaxRightUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreAjaxRightUnitTestController" ["Core\Controller\UnitTest\CoreContentUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreContentUnitTestController" ["Core\Controller\UnitTest\CoreCurrencyUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreCurrencyUnitTestController" ["Core\Controller\UnitTest\CoreDeliveryTypeUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreDeliveryTypeUnitTestController" ["Core\Controller\UnitTest\CoreEmailUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreEmailUnitTestController" ["Core\Controller\UnitTest\CoreEmailTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreEmailTypeUnitTestController" ["Core\Controller\UnitTest\CoreFormUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreFormUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldUnitTest"]=> string(56) "Core\Controller\UnitTest\CoreFormFieldUnitTestController" ["Core\Controller\UnitTest\CoreFormFieldsetUnitTest"]=> string(59) "Core\Controller\UnitTest\CoreFormFieldsetUnitTestController" ["Core\Controller\UnitTest\CoreLanguageUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreLanguageUnitTestController" ["Core\Controller\UnitTest\CoreLibraryUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreLibraryUnitTestController" ["Core\Controller\UnitTest\CoreLibraryTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryTypeUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreLibraryItemUnitTestController" ["Core\Controller\UnitTest\CoreLibraryItemTypeUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreLibraryItemTypeUnitTestController" ["Core\Controller\UnitTest\CoreMessageUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreMessageUnitTestController" ["Core\Controller\UnitTest\CoreModuleUnitTest"]=> string(53) "Core\Controller\UnitTest\CoreModuleUnitTestController" ["Core\Controller\UnitTest\CoreModuleParameterUnitTest"]=> string(62) "Core\Controller\UnitTest\CoreModuleParameterUnitTestController" ["Core\Controller\UnitTest\CorePageUnitTest"]=> string(51) "Core\Controller\UnitTest\CorePageUnitTestController" ["Core\Controller\UnitTest\CorePersonUnitTest"]=> string(53) "Core\Controller\UnitTest\CorePersonUnitTestController" ["Core\Controller\UnitTest\CorePersonRelationUnitTest"]=> string(61) "Core\Controller\UnitTest\CorePersonRelationUnitTestController" ["Core\Controller\UnitTest\CorePhoneUnitTest"]=> string(52) "Core\Controller\UnitTest\CorePhoneUnitTestController" ["Core\Controller\UnitTest\CorePhoneTypeUnitTest"]=> string(56) "Core\Controller\UnitTest\CorePhoneTypeUnitTestController" ["Core\Controller\UnitTest\CoreRightUnitTest"]=> string(52) "Core\Controller\UnitTest\CoreRightUnitTestController" ["Core\Controller\UnitTest\CoreRoleUnitTest"]=> string(51) "Core\Controller\UnitTest\CoreRoleUnitTestController" ["Core\Controller\UnitTest\CoreRoleTypeUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreRoleTypeUnitTestController" ["Core\Controller\UnitTest\CoreTemplateUnitTest"]=> string(55) "Core\Controller\UnitTest\CoreTemplateUnitTestController" ["Core\Controller\UnitTest\CoreTemplateGroupUnitTest"]=> string(60) "Core\Controller\UnitTest\CoreTemplateGroupUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteUnitTest"]=> string(54) "Core\Controller\UnitTest\CoreWebsiteUnitTestController" ["Core\Controller\UnitTest\CoreWebsiteTypeUnitTest"]=> string(58) "Core\Controller\UnitTest\CoreWebsiteTypeUnitTestController" ["QRCode\Controller\QRCode"]=> string(34) "QRCode\Controller\QRCodeController" ["QRCode\Controller\QRCodeAdmin"]=> string(39) "QRCode\Controller\QRCodeAdminController" ["QRCode\Controller\Access"]=> string(34) "QRCode\Controller\AccessController" ["QRCode\Controller\AccessAdmin"]=> string(39) "QRCode\Controller\AccessAdminController" ["Search\Controller\Search"]=> string(34) "Search\Controller\SearchController" ["Search\Controller\Index"]=> string(33) "Search\Controller\IndexController" ["Search\Controller\IndexAdmin"]=> string(38) "Search\Controller\IndexAdminController" } } ["translator"]=> array(2) { ["locale"]=> string(5) "fr_FR" ["translation_file_patterns"]=> array(1) { [0]=> array(3) { ["type"]=> string(7) "gettext" ["base_dir"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Core/config/../translations" ["pattern"]=> string(5) "%s.mo" } } } ["view_manager"]=> array(8) { ["doctype"]=> string(5) "HTML5" ["strategies"]=> array(1) { [0]=> string(16) "ViewJsonStrategy" } ["template_path_stack"]=> array(21) { ["core"]=> string(107) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/layouts" ["company"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Company/config/../view" ["shopstructureddata"]=> string(132) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopStructuredData/config/../view" ["contact"]=> string(121) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Contact/config/../view" ["galleries"]=> string(123) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Galleries/config/../view" ["logs"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Logs/config/../view" ["menu"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Menu/config/../view" ["qrcode"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/QRCode/config/../view" ["widget"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Widget/config/../view" ["search"]=> string(120) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Search/config/../view" ["products"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Products/config/../view" ["shop"]=> string(118) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Shop/config/../view" ["shopwinbiz"]=> string(124) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopWinBiz/config/../view" ["payments"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Payments/config/../view" ["testimonials"]=> string(126) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Testimonials/config/../view" ["shopanalytics"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/ShopAnalytics/config/../view" ["checkout"]=> string(122) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/module/Checkout/config/../view" ["Caveschateauauvernier"]=> string(149) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/releases/44/private/specific_site/module/Caveschateauauvernier/config/../view" ["views"]=> string(104) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view" ["layouts"]=> string(117) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas" ["customlayouts"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" } ["template_map"]=> array(3) { ["error/404"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/404.phtml" ["layout/layout"]=> string(137) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids/500.phtml" ["error/index"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module/Core/view/core/error/index.phtml" } ["not_found_template"]=> string(9) "error/404" ["exception_template"]=> string(11) "error/index" ["display_not_found_reason"]=> bool(true) ["display_exceptions"]=> bool(true) } ["navigation"]=> array(0) { } ["sentry"]=> array(2) { ["disable_module"]=> bool(false) ["options"]=> array(1) { ["dsn"]=> string(74) "https://0b5c664cafc349c5a5bed8048da6e011@o1176727.ingest.sentry.io/6276660" } } ["cache_rights"]=> bool(false) ["ajaxAdmin"]=> bool(true) ["externalModules"]=> bool(true) ["base_url"]=> string(2) "./" ["debug"]=> bool(true) ["defaultSiteName"]=> string(16) "chateauauvernier" ["defaultSiteId"]=> int(1) ["defaultHost"]=> string(24) "new.chateau-auvernier.ch" ["defaultIp"]=> string(9) "" ["defaultUserGroup"]=> int(1) ["rootPath"]=> string(79) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current" ["publicPath"]=> string(93) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public" ["dataPath"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data" ["applicationPath"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/module" ["cssResourcesCachePath"]=> string(103) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/css/cache" ["jsResourcesCachePath"]=> string(102) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/public/public/js/cache" ["resourcesExpirationTime"]=> string(29) "Tue, 04 Jul 2023 15:57:49 GMT" ["displaySitenameInUrl"]=> bool(false) ["logging"]=> array(4) { ["enabled"]=> bool(true) ["level"]=> int(3) ["fileName"]=> string(8) "site.log" ["path"]=> string(109) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/logs/chateauauvernier" } ["phpSettings"]=> array(4) { ["max_execution_time"]=> int(600) ["date.timezone"]=> string(13) "Europe/Zurich" ["display_startup_errors"]=> bool(true) ["display_errors"]=> bool(true) } ["db"]=> array(6) { ["driver"]=> string(3) "Pdo" ["dsn"]=> string(68) "mysql:dbname=dlxu_shop_chateauauvernier;host=dlxu.myd.infomaniak.com" ["driver_options"]=> array(3) { [1002]=> string(32) "SET NAMES 'UTF8', sql_mode = '';" [17]=> bool(false) [20]=> bool(false) } ["adapters"]=> array(1) { ["cmsAdapter"]=> array(4) { ["driver"]=> string(3) "Pdo" ["username"]=> string(0) "" ["password"]=> string(0) "" ["dsn"]=> string(19) "mysql:dbname=;host=" } } ["username"]=> string(15) "dlxu_shopdbuser" ["password"]=> string(12) "l_OSuAOz3kqr" } ["cache_path"]=> string(98) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/data/cache" ["cache_type"]=> string(10) "filesystem" ["cmsversion"]=> float(4) ["debugemail"]=> bool(false) ["dbdebug"]=> bool(false) ["dev"]=> bool(true) ["templatePath"]=> string(127) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private/specific_site/layouts-laminas/shopgrids" ["templateName"]=> string(9) "shopgrids" ["privatePath"]=> string(87) "/home/clients/71e2a4350287b9361a73f75772f44f0e/deploy/chateau-auvernier/current/private" ["sessionLifeTime"]=> string(4) "1440" } ["init":"Core\Module":private]=> bool(false) ["adminPage":"Core\Module":private]=> bool(false) ["isAjax":"Core\Module":private]=> bool(false) ["acl":"Core\Module":private]=> object(Shop\Model\Services\Override\Acl)#1425 (8) { ["serviceManager":protected]=> *RECURSION* ["redirectTo":protected]=> string(14) "/en/connection" ["roleRegistry":protected]=> NULL ["resources":protected]=> array(0) { } ["isAllowedRole":protected]=> NULL ["isAllowedResource":protected]=> NULL ["isAllowedPrivilege":protected]=> NULL ["rules":protected]=> array(2) { ["allResources"]=> array(2) { ["allRoles"]=> array(2) { ["allPrivileges"]=> array(2) { ["type"]=> string(9) "TYPE_DENY" ["assert"]=> NULL } ["byPrivilegeId"]=> array(0) { } } ["byRoleId"]=> array(0) { } } ["byResourceId"]=> array(0) { } } } ["tmpTest":"Core\Module":private]=> NULL ["initAjax"]=> int(0) } ["parameter"]=> array(1) { ["$sm"]=> string(10) "" } } ["Core\Front\Form\AddressTypeForm"]=> object(Closure)#55 (2) { ["this"]=> object(Core\Module)#50 (11) { ["defaultAdminLanguage":"Core\Module":private]=> string(2) "fr" ["requestedCmsObject":"Core\Module":private]=> object(Core\Model\Domain\CmsObject)#1164 (30) { ["objectId"]=> string(25) "EN_549296cbd43ea385133062" ["parentObjectId"]=> string(25) "EN_548aaba3ef08d749124007" ["objectTypeId"]=> string(1) "2" ["lngUnId"]=> string(22) "549296cbd43ea385133062" ["languageId"]=> string(2) "42" ["siteId"]=> string(1) "1" ["templateId"]=> string(2) "43" ["templateGroupId"]=> string(1) "1" ["last"]=> int(1) ["version"]=> int(1) ["active"]=> int(1) ["url"]=> string(0) "" ["status"]=> int(2) ["statusUserId"]=> string(1) "0" ["deleted"]=> int(0) ["deletedBy"]=> string(1) "0" ["published"]=> int(1) ["publishedBy"]=> string(1) "1" ["creationDate"]=> string(19) "2014-12-18 09:56:43" ["createdBy"]=> string(1) "1" ["updateDate"]=> string(19) "2014-12-18 09:56:43" ["updatedBy"]=> string(1) "1" ["publicationDateFrom"]=> string(19) "0000-00-00 00:00:00" ["publicationDateTo"]=> string(19) "0000-00-00 00:00:00" ["owner"]=> string(1) "1" ["displayOrder"]=> int(0) ["objectUrl"]=> NULL ["objectsFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } ["fieldsMap":protected]=> array(27) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" ["objectUrl"]=> string(10) "object_url" } ["localFieldsMap":protected]=> array(26) { ["objectId"]=> string(9) "object_id" ["parentObjectId"]=> string(16) "parent_object_id" ["objectTypeId"]=> string(14) "object_type_id" ["lngUnId"]=> string(9) "lng_un_id" ["languageId"]=> string(11) "language_id" ["siteId"]=> string(7) "site_id" ["templateId"]=> string(11) "template_id" ["templateGroupId"]=> string(17) "template_group_id" ["version"]=> string(7) "version" ["last"]=> string(4) "last" ["active"]=> string(6) "active" ["url"]=> string(3) "url" ["status"]=> string(6) "status" ["statusUserId"]=> string(14) "status_user_id" ["deleted"]=> string(7) "deleted" ["deletedBy"]=> string(10) "deleted_by" ["published"]=> string(9) "published" ["publishedBy"]=> string(12) "published_by" ["creationDate"]=> string(13) "creation_date" ["createdBy"]=> string(10) "created_by" ["updateDate"]=> string(11) "update_date" ["updatedBy"]=> string(10) "updated_by" ["publicationDateFrom"]=> string(21) "publication_date_from" ["publicationDateTo"]=> string(19) "publication_date_to" ["owner"]=> string(5) "owner" ["displayOrder"]=> string(13) "display_order" } } ["requestedObject":"Core\Module":private]=> NULL ["requestServerData":"Core\Module":private]=> object(Laminas\Stdlib\Parameters)#610 (1) { ["storage":"ArrayObject":private]=> array(62) { ["TEMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMPDIR"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["TMP"]=> string(50) "/home/clients/71e2a4350287b9361a73f75772f44f0e/tmp" ["ORIG_SCRIPT_NAME"]=> string(19) "/.fpm/php5.external" ["ORIG_PATH_TRANSLATED"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["ORIG_PATH_INFO"]=> string(17) "/public/index.php" ["ORIG_SCRIPT_FILENAME"]=> string(105) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/php5.external" ["SCRIPT_NAME"]=> string(17) "/public/index.php" ["REQUEST_URI"]=> string(58) "/en/shop/detailsen?id=6253d9fcc47bc657111855&catname=wines" ["QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REQUEST_METHOD"]=> string(3) "GET" ["SERVER_PROTOCOL"]=> string(8) "HTTP/1.1" ["GATEWAY_INTERFACE"]=> string(7) "CGI/1.1" ["REDIRECT_QUERY_STRING"]=> string(39) "id=6253d9fcc47bc657111855&catname=wines" ["REDIRECT_URL"]=> string(17) "/public/index.php" ["REMOTE_PORT"]=> string(5) "58056" ["SCRIPT_FILENAME"]=> string(94) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch/public/index.php" ["SERVER_ADMIN"]=> string(30) "webmaster@chateau-auvernier.ch" ["CONTEXT_DOCUMENT_ROOT"]=> string(92) "/home/clients/71e2a4350287b9361a73f75772f44f0e/.config/apache/new.chateau-auvernier.ch/.fpm/" ["CONTEXT_PREFIX"]=> string(6) "/.fpm/" ["REQUEST_SCHEME"]=> string(5) "https" ["DOCUMENT_ROOT"]=> string(77) "/home/clients/71e2a4350287b9361a73f75772f44f0e/sites/new.chateau-auvernier.ch" ["REMOTE_ADDR"]=> string(33) "2001:1600:4:b:1a66:daff:fe53:6382" ["SERVER_PORT"]=> string(3) "443" ["SERVER_ADDR"]=> string(10) "" ["SERVER_NAME"]=> string(20) "chateau-auvernier.ch" ["SERVER_SOFTWARE"]=> string(6) "Apache" ["SERVER_SIGNATURE"]=> string(0) "" ["PATH"]=> string(60) "/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin" ["HTTP_X_FORWARDED_PROTO"]=> string(5) "https" ["HTTP_CONNECTION"]=> string(5) "close" ["HTTP_X_FORWARDED_SERVER"]=> string(24) "new.chateau-auvernier.ch" ["HTTP_X_FORWARDED_HOST"]=> string(20) "chateau-auvernier.ch" ["HTTP_X_FORWARDED_FOR"]=> string(12) "" ["HTTP_ACCEPT_ENCODING"]=> string(7) "br,gzip" ["HTTP_ACCEPT_LANGUAGE"]=> string(14) "en-US,en;q=0.5" ["HTTP_ACCEPT"]=> string(63) "text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8" ["HTTP_USER_AGENT"]=> string(40) "CCBot/2.0 (https://commoncrawl.org/faq/)" ["HTTP_HOST"]=> string(20) "chateau-auvernier.ch" ["PHP_VERSION"]=> string(3) "8.0" ["SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["HTTPS"]=> string(2) "on" ["UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_HANDLER"]=> string(9) "php5-fcgi" ["REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["REDIRECT_REDIRECT_STATUS"]=> string(3) "200" ["REDIRECT_REDIRECT_proto"]=> string(5) "https" ["REDIRECT_REDIRECT_PHP_VERSION"]=> string(3) "8.0" ["REDIRECT_REDIRECT_SCRIPT_URI"]=> string(46) "https://chateau-auvernier.ch/en/shop/detailsen" ["REDIRECT_REDIRECT_SCRIPT_URL"]=> string(18) "/en/shop/detailsen" ["REDIRECT_REDIRECT_HTTPS"]=> string(2) "on" ["REDIRECT_REDIRECT_UNIQUE_ID"]=> string(27) "YsMN_SdyhaCipkFUcPV7xgAABoY" ["FCGI_ROLE"]=> string(9) "RESPONDER" ["PHP_SELF"]=> string(17) "/public/index.php" ["REQUEST_TIME_FLOAT"]=> float(1656950269.863278) ["REQUEST_TIME"]=> int(1656950269) } } ["config":"Core\Module":private]=> array(45) { ["service_manager"]=> array(4) { ["abstract_factories"]=> array(6) { [0]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [1]=> string(56) "Laminas\Cache\Service\StorageCacheAbstractServiceFactory" [2]=> string(51) "Laminas\Di\Container\ServiceManager\AutowireFactory" [3]=> string(39) "Laminas\Form\FormAbstractServiceFactory" [4]=> string(59) "Laminas\Navigation\Service\NavigationAbstractServiceFactory" [5]=> string(48) "Laminas\Db\Adapter\AdapterAbstractServiceFactory" } ["factories"]=> array(401) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> string(56) "Laminas\Cache\Service\StorageAdapterPluginManagerFactory" ["Laminas\Cache\Storage\PluginManager"]=> string(49) "Laminas\Cache\Service\StoragePluginManagerFactory" ["Laminas\Cache\Service\StoragePluginFactory"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StoragePluginFactoryInterface"]=> string(49) "Laminas\Cache\Service\StoragePluginFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactory"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Cache\Service\StorageAdapterFactoryInterface"]=> string(50) "Laminas\Cache\Service\StorageAdapterFactoryFactory" ["Laminas\Di\InjectorInterface"]=> string(36) "Laminas\Di\Container\InjectorFactory" ["Laminas\Di\ConfigInterface"]=> string(34) "Laminas\Di\Container\ConfigFactory" ["Laminas\Di\CodeGenerator\InjectorGenerator"]=> string(37) "Laminas\Di\Container\GeneratorFactory" ["Laminas\Mvc\I18n\Translator"]=> string(34) "Laminas\Mvc\I18n\TranslatorFactory" ["Laminas\InputFilter\InputFilterPluginManager"]=> string(51) "Laminas\InputFilter\InputFilterPluginManagerFactory" ["SerializerAdapterManager"]=> string(46) "Laminas\Serializer\AdapterPluginManagerFactory" ["Laminas\Router\Http\TreeRouteStack"]=> string(37) "Laminas\Router\Http\HttpRouterFactory" ["Laminas\Router\RoutePluginManager"]=> string(40) "Laminas\Router\RoutePluginManagerFactory" ["Laminas\Router\RouteStackInterface"]=> string(28) "Laminas\Router\RouterFactory" ["FormAnnotationBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormAttributeBuilder"]=> string(46) "Laminas\Form\Annotation\BuilderAbstractFactory" ["FormElementManager"]=> string(38) "Laminas\Form\FormElementManagerFactory" ["Laminas\Validator\ValidatorPluginManager"]=> string(47) "Laminas\Validator\ValidatorPluginManagerFactory" ["Laminas\Mail\Protocol\SmtpPluginManager"]=> string(46) "Laminas\Mail\Protocol\SmtpPluginManagerFactory" ["Laminas\I18n\Translator\TranslatorInterface"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["Laminas\I18n\Translator\LoaderPluginManager"]=> string(50) "Laminas\I18n\Translator\LoaderPluginManagerFactory" ["Laminas\Navigation\Navigation"]=> string(51) "Laminas\Navigation\Service\DefaultNavigationFactory" ["main-navigation"]=> string(34) "Core\Factory\MainNavigationFactory" ["admin-navigation"]=> string(39) "Core\Factory\AdminMainNavigationFactory" ["translator"]=> string(48) "Laminas\I18n\Translator\TranslatorServiceFactory" ["CoreManager"]=> string(39) "Core\Factory\Manager\CoreManagerFactory" ["Core\Model\Services\ControllerActionManagerLaminas"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDaoLaminas"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["ControllerActionGatewayLaminas"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\PageManagerLaminas"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDaoLaminas"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["PageGatewayLaminas"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\CmsObjectManager"]=> string(44) "Core\Factory\Manager\CmsObjectManagerFactory" ["Core\Model\Dao\CmsObjectDao"]=> string(36) "Core\Factory\Dao\CmsObjectDaoFactory" ["CmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\CoreModuleManager"]=> string(45) "Core\Factory\Manager\CoreModuleManagerFactory" ["Core\Model\Services\AddressManager"]=> string(42) "Core\Factory\Manager\AddressManagerFactory" ["Core\Model\Dao\AddressDao"]=> string(34) "Core\Factory\Dao\AddressDaoFactory" ["CoreAddressGateway"]=> string(42) "Core\Factory\Gateway\AddressGatewayFactory" ["Core\Model\Services\AddressTypeManager"]=> string(46) "Core\Factory\Manager\AddressTypeManagerFactory" ["Core\Model\Dao\AddressTypeDao"]=> string(38) "Core\Factory\Dao\AddressTypeDaoFactory" ["CoreAddressTypeGateway"]=> string(46) "Core\Factory\Gateway\AddressTypeGatewayFactory" ["Core\Model\Services\AjaxRightManager"]=> string(44) "Core\Factory\Manager\AjaxRightManagerFactory" ["Core\Model\Dao\AjaxRightDao"]=> string(36) "Core\Factory\Dao\AjaxRightDaoFactory" ["CoreAjaxRightGateway"]=> string(44) "Core\Factory\Gateway\AjaxRightGatewayFactory" ["Core\Model\Services\BankManager"]=> string(39) "Core\Factory\Manager\BankManagerFactory" ["Core\Model\Dao\BankDao"]=> string(31) "Core\Factory\Dao\BankDaoFactory" ["CoreBankGateway"]=> string(39) "Core\Factory\Gateway\BankGatewayFactory" ["Core\Model\Services\BankAccountManager"]=> string(46) "Core\Factory\Manager\BankAccountManagerFactory" ["Core\Model\Dao\BankAccountDao"]=> string(38) "Core\Factory\Dao\BankAccountDaoFactory" ["CoreBankAccountGateway"]=> string(46) "Core\Factory\Gateway\BankAccountGatewayFactory" ["Core\Model\Services\BankAddressManager"]=> string(46) "Core\Factory\Manager\BankAddressManagerFactory" ["Core\Model\Dao\BankAddressDao"]=> string(38) "Core\Factory\Dao\BankAddressDaoFactory" ["CoreBankAddressGateway"]=> string(46) "Core\Factory\Gateway\BankAddressGatewayFactory" ["Core\Model\Services\CertificateManager"]=> string(46) "Core\Factory\Manager\CertificateManagerFactory" ["Core\Model\Dao\CertificateDao"]=> string(38) "Core\Factory\Dao\CertificateDaoFactory" ["CoreCertificateGateway"]=> string(46) "Core\Factory\Gateway\CertificateGatewayFactory" ["Core\Model\Services\ClosedDayManager"]=> string(44) "Core\Factory\Manager\ClosedDayManagerFactory" ["Core\Model\Dao\ClosedDayDao"]=> string(36) "Core\Factory\Dao\ClosedDayDaoFactory" ["CoreClosedDayGateway"]=> string(44) "Core\Factory\Gateway\ClosedDayGatewayFactory" ["Core\Model\Services\ClosedDayTypeManager"]=> string(48) "Core\Factory\Manager\ClosedDayTypeManagerFactory" ["Core\Model\Dao\ClosedDayTypeDao"]=> string(40) "Core\Factory\Dao\ClosedDayTypeDaoFactory" ["CoreClosedDayTypeGateway"]=> string(48) "Core\Factory\Gateway\ClosedDayTypeGatewayFactory" ["Core\Model\Services\CmsListManager"]=> string(42) "Core\Factory\Manager\CmsListManagerFactory" ["Core\Model\Dao\CmsListDao"]=> string(34) "Core\Factory\Dao\CmsListDaoFactory" ["CoreCmsListGateway"]=> string(42) "Core\Factory\Gateway\CmsListGatewayFactory" ["Core\Model\Services\CmsListItemManager"]=> string(46) "Core\Factory\Manager\CmsListItemManagerFactory" ["Core\Model\Dao\CmsListItemDao"]=> string(38) "Core\Factory\Dao\CmsListItemDaoFactory" ["CoreCmsListItemGateway"]=> string(46) "Core\Factory\Gateway\CmsListItemGatewayFactory" ["Core\Model\Services\ContentManager"]=> string(42) "Core\Factory\Manager\ContentManagerFactory" ["Core\Model\Dao\ContentDao"]=> string(34) "Core\Factory\Dao\ContentDaoFactory" ["CoreContentGateway"]=> string(42) "Core\Factory\Gateway\ContentGatewayFactory" ["CoreCmsObjectGateway"]=> string(44) "Core\Factory\Gateway\CmsObjectGatewayFactory" ["Core\Model\Services\CmsObjectTypeManager"]=> string(48) "Core\Factory\Manager\CmsObjectTypeManagerFactory" ["Core\Model\Dao\CmsObjectTypeDao"]=> string(40) "Core\Factory\Dao\CmsObjectTypeDaoFactory" ["CoreCmsObjectTypeGateway"]=> string(48) "Core\Factory\Gateway\CmsObjectTypeGatewayFactory" ["Core\Model\Services\CmsObjectPropertyManager"]=> string(52) "Core\Factory\Manager\CmsObjectPropertyManagerFactory" ["Core\Model\Dao\CmsObjectPropertyDao"]=> string(44) "Core\Factory\Dao\CmsObjectPropertyDaoFactory" ["CoreCmsObjectPropertyGateway"]=> string(52) "Core\Factory\Gateway\CmsObjectPropertyGatewayFactory" ["Core\Model\Services\CmsObjectPropertyTypeManager"]=> string(56) "Core\Factory\Manager\CmsObjectPropertyTypeManagerFactory" ["Core\Model\Dao\CmsObjectPropertyTypeDao"]=> string(48) "Core\Factory\Dao\CmsObjectPropertyTypeDaoFactory" ["CoreCmsObjectPropertyTypeGateway"]=> string(56) "Core\Factory\Gateway\CmsObjectPropertyTypeGatewayFactory" ["Core\Model\Services\ControllerActionManager"]=> string(51) "Core\Factory\Manager\ControllerActionManagerFactory" ["Core\Model\Dao\ControllerActionDao"]=> string(43) "Core\Factory\Dao\ControllerActionDaoFactory" ["CoreControllerActionGateway"]=> string(51) "Core\Factory\Gateway\ControllerActionGatewayFactory" ["Core\Model\Services\ControllerActionTemplateManager"]=> string(59) "Core\Factory\Manager\ControllerActionTemplateManagerFactory" ["Core\Model\Dao\ControllerActionTemplateDao"]=> string(51) "Core\Factory\Dao\ControllerActionTemplateDaoFactory" ["CoreControllerActionTemplateGateway"]=> string(59) "Core\Factory\Gateway\ControllerActionTemplateGatewayFactory" ["Core\Model\Services\CurrencyManager"]=> string(43) "Core\Factory\Manager\CurrencyManagerFactory" ["Core\Model\Dao\CurrencyDao"]=> string(35) "Core\Factory\Dao\CurrencyDaoFactory" ["CoreCurrencyGateway"]=> string(43) "Core\Factory\Gateway\CurrencyGatewayFactory" ["Core\Model\Services\CityManager"]=> string(39) "Core\Factory\Manager\CityManagerFactory" ["Core\Model\Dao\CityDao"]=> string(31) "Core\Factory\Dao\CityDaoFactory" ["CoreCityGateway"]=> string(39) "Core\Factory\Gateway\CityGatewayFactory" ["Core\Model\Services\CmsUserManager"]=> string(42) "Core\Factory\Manager\CmsUserManagerFactory" ["Core\Model\Dao\CmsUserDao"]=> string(34) "Core\Factory\Dao\CmsUserDaoFactory" ["CoreCmsUserGateway"]=> string(42) "Core\Factory\Gateway\CmsUserGatewayFactory" ["Core\Model\Services\ContinentManager"]=> string(44) "Core\Factory\Manager\ContinentManagerFactory" ["Core\Model\Dao\ContinentDao"]=> string(36) "Core\Factory\Dao\ContinentDaoFactory" ["CoreContinentGateway"]=> string(44) "Core\Factory\Gateway\ContinentGatewayFactory" ["Core\Model\Services\CountryManager"]=> string(42) "Core\Factory\Manager\CountryManagerFactory" ["Core\Model\Dao\CountryDao"]=> string(34) "Core\Factory\Dao\CountryDaoFactory" ["CoreCountryGateway"]=> string(42) "Core\Factory\Gateway\CountryGatewayFactory" ["Core\Model\Services\DebugIpManager"]=> string(42) "Core\Factory\Manager\DebugIpManagerFactory" ["Core\Model\Dao\DebugIpDao"]=> string(34) "Core\Factory\Dao\DebugIpDaoFactory" ["CoreDebugIpGateway"]=> string(42) "Core\Factory\Gateway\DebugIpGatewayFactory" ["Core\Model\Services\DeliveryTypeManager"]=> string(47) "Core\Factory\Manager\DeliveryTypeManagerFactory" ["Core\Model\Dao\DeliveryTypeDao"]=> string(39) "Core\Factory\Dao\DeliveryTypeDaoFactory" ["CoreDeliveryTypeGateway"]=> string(47) "Core\Factory\Gateway\DeliveryTypeGatewayFactory" ["Core\Model\Services\EmailManager"]=> string(40) "Core\Factory\Manager\EmailManagerFactory" ["Core\Model\Dao\EmailDao"]=> string(32) "Core\Factory\Dao\EmailDaoFactory" ["CoreEmailGateway"]=> string(40) "Core\Factory\Gateway\EmailGatewayFactory" ["Core\Model\Services\EmailMessageManager"]=> string(47) "Core\Factory\Manager\EmailMessageManagerFactory" ["Core\Model\Dao\EmailMessageDao"]=> string(39) "Core\Factory\Dao\EmailMessageDaoFactory" ["CoreEmailMessageGateway"]=> string(47) "Core\Factory\Gateway\EmailMessageGatewayFactory" ["Core\Model\Services\EmailTypeManager"]=> string(44) "Core\Factory\Manager\EmailTypeManagerFactory" ["Core\Model\Dao\EmailTypeDao"]=> string(36) "Core\Factory\Dao\EmailTypeDaoFactory" ["CoreEmailTypeGateway"]=> string(44) "Core\Factory\Gateway\EmailTypeGatewayFactory" ["Core\Model\Services\EntityRightManager"]=> string(46) "Core\Factory\Manager\EntityRightManagerFactory" ["Core\Model\Dao\EntityRightDao"]=> string(38) "Core\Factory\Dao\EntityRightDaoFactory" ["CoreEntityRightGateway"]=> string(46) "Core\Factory\Gateway\EntityRightGatewayFactory" ["Core\Model\Services\ExtranetUserManager"]=> string(47) "Core\Factory\Manager\ExtranetUserManagerFactory" ["Core\Model\Dao\ExtranetUserDao"]=> string(39) "Shop\Factory\Dao\ExtranetUserDaoFactory" ["CoreExtranetUserGateway"]=> string(47) "Core\Factory\Gateway\ExtranetUserGatewayFactory" ["Core\Model\Services\FormManager"]=> string(39) "Core\Factory\Manager\FormManagerFactory" ["Core\Model\Dao\FormDao"]=> string(31) "Core\Factory\Dao\FormDaoFactory" ["CoreFormGateway"]=> string(39) "Core\Factory\Gateway\FormGatewayFactory" ["Core\Model\Services\FormFieldsetManager"]=> string(47) "Core\Factory\Manager\FormFieldsetManagerFactory" ["Core\Model\Dao\FormFieldsetDao"]=> string(39) "Core\Factory\Dao\FormFieldsetDaoFactory" ["CoreFormFieldsetGateway"]=> string(47) "Core\Factory\Gateway\FormFieldsetGatewayFactory" ["Core\Model\Services\FormFieldManager"]=> string(44) "Core\Factory\Manager\FormFieldManagerFactory" ["Core\Model\Dao\FormFieldDao"]=> string(36) "Core\Factory\Dao\FormFieldDaoFactory" ["CoreFormFieldGateway"]=> string(44) "Core\Factory\Gateway\FormFieldGatewayFactory" ["Core\Model\Services\LanguageManager"]=> string(43) "Core\Factory\Manager\LanguageManagerFactory" ["Core\Model\Dao\LanguageDao"]=> string(35) "Core\Factory\Dao\LanguageDaoFactory" ["CoreLanguageGateway"]=> string(43) "Core\Factory\Gateway\LanguageGatewayFactory" ["Core\Model\Services\LibraryManager"]=> string(42) "Core\Factory\Manager\LibraryManagerFactory" ["Core\Model\Dao\LibraryDao"]=> string(34) "Core\Factory\Dao\LibraryDaoFactory" ["CoreLibraryGateway"]=> string(42) "Core\Factory\Gateway\LibraryGatewayFactory" ["Core\Model\Services\LibraryTypeManager"]=> string(46) "Core\Factory\Manager\LibraryTypeManagerFactory" ["Core\Model\Dao\LibraryTypeDao"]=> string(38) "Core\Factory\Dao\LibraryTypeDaoFactory" ["CoreLibraryTypeGateway"]=> string(46) "Core\Factory\Gateway\LibraryTypeGatewayFactory" ["Core\Model\Services\LibraryItemManager"]=> string(46) "Core\Factory\Manager\LibraryItemManagerFactory" ["Core\Model\Dao\LibraryItemDao"]=> string(38) "Core\Factory\Dao\LibraryItemDaoFactory" ["CoreLibraryItemGateway"]=> string(46) "Core\Factory\Gateway\LibraryItemGatewayFactory" ["Core\Model\Services\LibraryItemTypeManager"]=> string(50) "Core\Factory\Manager\LibraryItemTypeManagerFactory" ["Core\Model\Dao\LibraryItemTypeDao"]=> string(42) "Core\Factory\Dao\LibraryItemTypeDaoFactory" ["CoreLibraryItemTypeGateway"]=> string(50) "Core\Factory\Gateway\LibraryItemTypeGatewayFactory" ["Core\Model\Services\MessageManager"]=> string(42) "Core\Factory\Manager\MessageManagerFactory" ["Core\Model\Dao\MessageDao"]=> string(34) "Core\Factory\Dao\MessageDaoFactory" ["CoreMessageGateway"]=> string(42) "Core\Factory\Gateway\MessageGatewayFactory" ["Core\Model\Services\ModuleManager"]=> string(41) "Core\Factory\Manager\ModuleManagerFactory" ["Core\Model\Dao\ModuleDao"]=> string(33) "Core\Factory\Dao\ModuleDaoFactory" ["CoreModuleGateway"]=> string(41) "Core\Factory\Gateway\ModuleGatewayFactory" ["Core\Model\Services\ModuleParameterManager"]=> string(50) "Core\Factory\Manager\ModuleParameterManagerFactory" ["Core\Model\Dao\ModuleParameterDao"]=> string(42) "Core\Factory\Dao\ModuleParameterDaoFactory" ["CoreModuleParameterGateway"]=> string(50) "Core\Factory\Gateway\ModuleParameterGatewayFactory" ["Core\Model\Services\PageManager"]=> string(39) "Core\Factory\Manager\PageManagerFactory" ["Core\Model\Dao\PageDao"]=> string(31) "Core\Factory\Dao\PageDaoFactory" ["CorePageGateway"]=> string(39) "Core\Factory\Gateway\PageGatewayFactory" ["Core\Model\Services\PersonManager"]=> string(41) "Core\Factory\Manager\PersonManagerFactory" ["Core\Model\Dao\PersonDao"]=> string(33) "Core\Factory\Dao\PersonDaoFactory" ["CorePersonGateway"]=> string(41) "Core\Factory\Gateway\PersonGatewayFactory" ["Core\Model\Services\PersonRelationManager"]=> string(49) "Core\Factory\Manager\PersonRelationManagerFactory" ["Core\Model\Dao\PersonRelationDao"]=> string(41) "Core\Factory\Dao\PersonRelationDaoFactory" ["CorePersonRelationGateway"]=> string(49) "Core\Factory\Gateway\PersonRelationGatewayFactory" ["Core\Model\Services\PhoneManager"]=> string(40) "Core\Factory\Manager\PhoneManagerFactory" ["Core\Model\Dao\PhoneDao"]=> string(32) "Core\Factory\Dao\PhoneDaoFactory" ["CorePhoneGateway"]=> string(40) "Core\Factory\Gateway\PhoneGatewayFactory" ["Core\Model\Services\PhoneTypeManager"]=> string(44) "Core\Factory\Manager\PhoneTypeManagerFactory" ["Core\Model\Dao\PhoneTypeDao"]=> string(36) "Core\Factory\Dao\PhoneTypeDaoFactory" ["CorePhoneTypeGateway"]=> string(44) "Core\Factory\Gateway\PhoneTypeGatewayFactory" ["Core\Model\Services\RightManager"]=> string(40) "Core\Factory\Manager\RightManagerFactory" ["Core\Model\Dao\RightDao"]=> string(32) "Core\Factory\Dao\RightDaoFactory" ["CoreRightGateway"]=> string(40) "Core\Factory\Gateway\RightGatewayFactory" ["Core\Model\Services\RoleManager"]=> string(39) "Core\Factory\Manager\RoleManagerFactory" ["Core\Model\Dao\RoleDao"]=> string(31) "Core\Factory\Dao\RoleDaoFactory" ["CoreRoleGateway"]=> string(39) "Core\Factory\Gateway\RoleGatewayFactory" ["Core\Model\Services\RoleTypeManager"]=> string(43) "Core\Factory\Manager\RoleTypeManagerFactory" ["Core\Model\Dao\RoleTypeDao"]=> string(35) "Core\Factory\Dao\RoleTypeDaoFactory" ["CoreRoleTypeGateway"]=> string(43) "Core\Factory\Gateway\RoleTypeGatewayFactory" ["Core\Model\Services\RouteManager"]=> string(40) "Core\Factory\Manager\RouteManagerFactory" ["Core\Model\Dao\RouteDao"]=> string(32) "Core\Factory\Dao\RouteDaoFactory" ["CoreRouteGateway"]=> string(40) "Core\Factory\Gateway\RouteGatewayFactory" ["Core\Model\Services\ShortUrlManager"]=> string(43) "Core\Factory\Manager\ShortUrlManagerFactory" ["Core\Model\Dao\ShortUrlDao"]=> string(35) "Core\Factory\Dao\ShortUrlDaoFactory" ["CoreShortUrlGateway"]=> string(43) "Core\Factory\Gateway\ShortUrlGatewayFactory" ["Core\Model\Services\SiteManager"]=> string(39) "Core\Factory\Manager\SiteManagerFactory" ["Core\Model\Dao\SiteDao"]=> string(31) "Core\Factory\Dao\SiteDaoFactory" ["CoreSiteGateway"]=> string(39) "Core\Factory\Gateway\SiteGatewayFactory" ["Core\Model\Services\SiteDomainManager"]=> string(45) "Core\Factory\Manager\SiteDomainManagerFactory" ["Core\Model\Dao\SiteDomainDao"]=> string(37) "Core\Factory\Dao\SiteDomainDaoFactory" ["CoreSiteDomainGateway"]=> string(45) "Core\Factory\Gateway\SiteDomainGatewayFactory" ["Core\Model\Services\StateManager"]=> string(40) "Core\Factory\Manager\StateManagerFactory" ["Core\Model\Dao\StateDao"]=> string(32) "Core\Factory\Dao\StateDaoFactory" ["CoreStateGateway"]=> string(40) "Core\Factory\Gateway\StateGatewayFactory" ["Core\Model\Services\TemplateManager"]=> string(43) "Core\Factory\Manager\TemplateManagerFactory" ["Core\Model\Dao\TemplateDao"]=> string(35) "Core\Factory\Dao\TemplateDaoFactory" ["CoreTemplateGateway"]=> string(43) "Core\Factory\Gateway\TemplateGatewayFactory" ["Core\Model\Services\TemplateGroupManager"]=> string(48) "Core\Factory\Manager\TemplateGroupManagerFactory" ["Core\Model\Dao\TemplateGroupDao"]=> string(40) "Core\Factory\Dao\TemplateGroupDaoFactory" ["CoreTemplateGroupGateway"]=> string(48) "Core\Factory\Gateway\TemplateGroupGatewayFactory" ["Core\Model\Services\UserManager"]=> string(39) "Core\Factory\Manager\UserManagerFactory" ["Core\Model\Dao\UserDao"]=> string(31) "Core\Factory\Dao\UserDaoFactory" ["CoreUserGateway"]=> string(39) "Core\Factory\Gateway\UserGatewayFactory" ["Core\Model\Services\UserRoleManager"]=> string(43) "Core\Factory\Manager\UserRoleManagerFactory" ["Core\Model\Dao\UserRoleDao"]=> string(35) "Core\Factory\Dao\UserRoleDaoFactory" ["CoreUserRoleGateway"]=> string(43) "Core\Factory\Gateway\UserRoleGatewayFactory" ["Core\Model\Services\UserFavoritObjectManager"]=> string(52) "Core\Factory\Manager\UserFavoritObjectManagerFactory" ["Core\Model\Dao\UserFavoritObjectDao"]=> string(44) "Core\Factory\Dao\UserFavoritObjectDaoFactory" ["CoreUserFavoritObjectGateway"]=> string(52) "Core\Factory\Gateway\UserFavoritObjectGatewayFactory" ["Core\Model\Services\UserSessionManager"]=> string(46) "Core\Factory\Manager\UserSessionManagerFactory" ["Core\Model\Dao\UserSessionDao"]=> string(38) "Core\Factory\Dao\UserSessionDaoFactory" ["CoreUserSessionGateway"]=> string(46) "Core\Factory\Gateway\UserSessionGatewayFactory" ["Core\Model\Services\WebsiteManager"]=> string(42) "Core\Factory\Manager\WebsiteManagerFactory" ["Core\Model\Dao\WebsiteDao"]=> string(34) "Core\Factory\Dao\WebsiteDaoFactory" ["CoreWebsiteGateway"]=> string(42) "Core\Factory\Gateway\WebsiteGatewayFactory" ["Core\Model\Services\WebsiteTypeManager"]=> string(46) "Core\Factory\Manager\WebsiteTypeManagerFactory" ["Core\Model\Dao\WebsiteTypeDao"]=> string(38) "Core\Factory\Dao\WebsiteTypeDaoFactory" ["CoreWebsiteTypeGateway"]=> string(46) "Core\Factory\Gateway\WebsiteTypeGatewayFactory" ["CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyModuleManager"]=> string(51) "Company\Factory\Manager\CompanyModuleManagerFactory" ["Company\Model\Services\CompanyManager"]=> string(45) "Company\Factory\Manager\CompanyManagerFactory" ["Company\Model\Dao\CompanyDao"]=> string(37) "Company\Factory\Dao\CompanyDaoFactory" ["CompanyCompanyGateway"]=> string(45) "Company\Factory\Gateway\CompanyGatewayFactory" ["Company\Model\Services\DomainManager"]=> string(44) "Company\Factory\Manager\DomainManagerFactory" ["Company\Model\Dao\DomainDao"]=> string(36) "Company\Factory\Dao\DomainDaoFactory" ["CompanyDomainGateway"]=> string(44) "Company\Factory\Gateway\DomainGatewayFactory" ["Company\Model\Services\CompanyFunctionManager"]=> string(53) "Company\Factory\Manager\CompanyFunctionManagerFactory" ["Company\Model\Dao\CompanyFunctionDao"]=> string(45) "Company\Factory\Dao\CompanyFunctionDaoFactory" ["CompanyCompanyFunctionGateway"]=> string(53) "Company\Factory\Gateway\CompanyFunctionGatewayFactory" ["Company\Model\Services\EmployeeManager"]=> string(46) "Company\Factory\Manager\EmployeeManagerFactory" ["Company\Model\Dao\EmployeeDao"]=> string(38) "Company\Factory\Dao\EmployeeDaoFactory" ["CompanyEmployeeGateway"]=> string(46) "Company\Factory\Gateway\EmployeeGatewayFactory" ["Company\Model\Services\ContractManager"]=> string(46) "Company\Factory\Manager\ContractManagerFactory" ["Company\Model\Dao\ContractDao"]=> string(38) "Company\Factory\Dao\ContractDaoFactory" ["CompanyContractGateway"]=> string(46) "Company\Factory\Gateway\ContractGatewayFactory" ["Company\Model\Services\ContractTypeManager"]=> string(50) "Company\Factory\Manager\ContractTypeManagerFactory" ["Company\Model\Dao\ContractTypeDao"]=> string(42) "Company\Factory\Dao\ContractTypeDaoFactory" ["CompanyContractTypeGateway"]=> string(50) "Company\Factory\Gateway\ContractTypeGatewayFactory" ["StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["StructuredData\Model\Services\StructuredDataModuleManager"]=> string(65) "StructuredData\Factory\Manager\StructuredDataModuleManagerFactory" ["ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactModuleManager"]=> string(51) "Contact\Factory\Manager\ContactModuleManagerFactory" ["Contact\Model\Services\ContactManager"]=> string(45) "Contact\Factory\Manager\ContactManagerFactory" ["Contact\Model\Dao\ContactDao"]=> string(37) "Contact\Factory\Dao\ContactDaoFactory" ["ContactContactGateway"]=> string(45) "Contact\Factory\Gateway\ContactGatewayFactory" ["Contact\Model\Services\ContactAnswerManager"]=> string(51) "Contact\Factory\Manager\ContactAnswerManagerFactory" ["Contact\Model\Dao\ContactAnswerDao"]=> string(43) "Contact\Factory\Dao\ContactAnswerDaoFactory" ["ContactContactAnswerGateway"]=> string(51) "Contact\Factory\Gateway\ContactAnswerGatewayFactory" ["Contact\Model\Services\ContactCommentManager"]=> string(52) "Contact\Factory\Manager\ContactCommentManagerFactory" ["Contact\Model\Dao\ContactCommentDao"]=> string(44) "Contact\Factory\Dao\ContactCommentDaoFactory" ["ContactContactCommentGateway"]=> string(52) "Contact\Factory\Gateway\ContactCommentGatewayFactory" ["Contact\Model\Services\ContactStatusManager"]=> string(51) "Contact\Factory\Manager\ContactStatusManagerFactory" ["Contact\Model\Dao\ContactStatusDao"]=> string(43) "Contact\Factory\Dao\ContactStatusDaoFactory" ["ContactContactStatusGateway"]=> string(51) "Contact\Factory\Gateway\ContactStatusGatewayFactory" ["GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleriesModuleManager"]=> string(55) "Galleries\Factory\Manager\GalleriesModuleManagerFactory" ["Galleries\Model\Services\GalleryManager"]=> string(47) "Galleries\Factory\Manager\GalleryManagerFactory" ["Galleries\Model\Dao\GalleryDao"]=> string(39) "Galleries\Factory\Dao\GalleryDaoFactory" ["GalleriesGalleryGateway"]=> string(47) "Galleries\Factory\Gateway\GalleryGatewayFactory" ["Galleries\Model\Services\ItemManager"]=> string(44) "Galleries\Factory\Manager\ItemManagerFactory" ["Galleries\Model\Dao\ItemDao"]=> string(36) "Galleries\Factory\Dao\ItemDaoFactory" ["GalleriesItemGateway"]=> string(44) "Galleries\Factory\Gateway\ItemGatewayFactory" ["Galleries\Model\Services\ItemTypeManager"]=> string(48) "Galleries\Factory\Manager\ItemTypeManagerFactory" ["Galleries\Model\Dao\ItemTypeDao"]=> string(40) "Galleries\Factory\Dao\ItemTypeDaoFactory" ["GalleriesItemTypeGateway"]=> string(48) "Galleries\Factory\Gateway\ItemTypeGatewayFactory" ["Galleries\Model\Services\ItemCommentManager"]=> string(51) "Galleries\Factory\Manager\ItemCommentManagerFactory" ["Galleries\Model\Dao\ItemCommentDao"]=> string(43) "Galleries\Factory\Dao\ItemCommentDaoFactory" ["GalleriesItemCommentGateway"]=> string(51) "Galleries\Factory\Gateway\ItemCommentGatewayFactory" ["LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogsModuleManager"]=> string(45) "Logs\Factory\Manager\LogsModuleManagerFactory" ["Logs\Model\Services\LogManager"]=> string(38) "Logs\Factory\Manager\LogManagerFactory" ["Logs\Model\Dao\LogDao"]=> string(30) "Logs\Factory\Dao\LogDaoFactory" ["LogsLogGateway"]=> string(38) "Logs\Factory\Gateway\LogGatewayFactory" ["MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuModuleManager"]=> string(45) "Menu\Factory\Manager\MenuModuleManagerFactory" ["Menu\Model\Services\MenuManager"]=> string(39) "Menu\Factory\Manager\MenuManagerFactory" ["Menu\Model\Dao\MenuDao"]=> string(31) "Menu\Factory\Dao\MenuDaoFactory" ["MenuMenuGateway"]=> string(39) "Menu\Factory\Gateway\MenuGatewayFactory" ["Menu\Model\Services\MenuItemManager"]=> string(43) "Menu\Factory\Manager\MenuItemManagerFactory" ["Menu\Model\Dao\MenuItemDao"]=> string(35) "Menu\Factory\Dao\MenuItemDaoFactory" ["MenuMenuItemGateway"]=> string(43) "Menu\Factory\Gateway\MenuItemGatewayFactory" ["WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetModuleManager"]=> string(49) "Widget\Factory\Manager\WidgetModuleManagerFactory" ["Widget\Model\Services\WidgetManager"]=> string(43) "Widget\Factory\Manager\WidgetManagerFactory" ["Widget\Model\Dao\WidgetDao"]=> string(35) "Widget\Factory\Dao\WidgetDaoFactory" ["WidgetWidgetGateway"]=> string(43) "Widget\Factory\Gateway\WidgetGatewayFactory" ["Widget\Model\Services\WidgetPositionManager"]=> string(51) "Widget\Factory\Manager\WidgetPositionManagerFactory" ["Widget\Model\Dao\WidgetPositionDao"]=> string(43) "Widget\Factory\Dao\WidgetPositionDaoFactory" ["WidgetWidgetPositionGateway"]=> string(51) "Widget\Factory\Gateway\WidgetPositionGatewayFactory" ["ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductsModuleManager"]=> string(53) "Products\Factory\Manager\ProductsModuleManagerFactory" ["Products\Model\Services\ProductManager"]=> string(46) "Products\Factory\Manager\ProductManagerFactory" ["Products\Model\Dao\ProductDao"]=> string(38) "Products\Factory\Dao\ProductDaoFactory" ["ProductsProductGateway"]=> string(46) "Products\Factory\Gateway\ProductGatewayFactory" ["Products\Model\Services\CategoryManager"]=> string(47) "Products\Factory\Manager\CategoryManagerFactory" ["Products\Model\Dao\CategoryDao"]=> string(39) "Products\Factory\Dao\CategoryDaoFactory" ["ProductsCategoryGateway"]=> string(47) "Products\Factory\Gateway\CategoryGatewayFactory" ["Products\Model\Services\ProductTypeManager"]=> string(50) "Products\Factory\Manager\ProductTypeManagerFactory" ["Products\Model\Dao\ProductTypeDao"]=> string(42) "Products\Factory\Dao\ProductTypeDaoFactory" ["ProductsProductTypeGateway"]=> string(50) "Products\Factory\Gateway\ProductTypeGatewayFactory" ["Products\Model\Services\BrandManager"]=> string(44) "Products\Factory\Manager\BrandManagerFactory" ["Products\Model\Dao\BrandDao"]=> string(36) "Products\Factory\Dao\BrandDaoFactory" ["ProductsBrandGateway"]=> string(44) "Products\Factory\Gateway\BrandGatewayFactory" ["Products\Model\Services\CriteriaManager"]=> string(47) "Products\Factory\Manager\CriteriaManagerFactory" ["Products\Model\Dao\CriteriaDao"]=> string(39) "Products\Factory\Dao\CriteriaDaoFactory" ["ProductsCriteriaGateway"]=> string(47) "Products\Factory\Gateway\CriteriaGatewayFactory" ["ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopModuleManager"]=> string(45) "Shop\Factory\Manager\ShopModuleManagerFactory" ["Shop\Model\Services\ShopManager"]=> string(39) "Shop\Factory\Manager\ShopManagerFactory" ["Shop\Model\Dao\ShopDao"]=> string(31) "Shop\Factory\Dao\ShopDaoFactory" ["ShopShopGateway"]=> string(39) "Shop\Factory\Gateway\ShopGatewayFactory" ["Shop\Model\Services\ShopProductManager"]=> string(63) "Caveschateauauvernier\Factory\Manager\ShopProductManagerFactory" ["Shop\Model\Dao\ShopProductDao"]=> string(38) "Shop\Factory\Dao\ShopProductDaoFactory" ["ShopShopProductGateway"]=> string(46) "Shop\Factory\Gateway\ShopProductGatewayFactory" ["Shop\Model\Services\CategoryManager"]=> string(43) "Shop\Factory\Manager\CategoryManagerFactory" ["Shop\Model\Dao\CategoryDao"]=> string(35) "Shop\Factory\Dao\CategoryDaoFactory" ["ShopCategoryGateway"]=> string(43) "Shop\Factory\Gateway\CategoryGatewayFactory" ["Shop\Model\Services\OrderManager"]=> string(40) "Shop\Factory\Manager\OrderManagerFactory" ["Shop\Model\Dao\OrderDao"]=> string(32) "Shop\Factory\Dao\OrderDaoFactory" ["ShopOrderGateway"]=> string(40) "Shop\Factory\Gateway\OrderGatewayFactory" ["Shop\Model\Services\OrderItemManager"]=> string(44) "Shop\Factory\Manager\OrderItemManagerFactory" ["Shop\Model\Dao\OrderItemDao"]=> string(36) "Shop\Factory\Dao\OrderItemDaoFactory" ["ShopOrderItemGateway"]=> string(44) "Shop\Factory\Gateway\OrderItemGatewayFactory" ["Shop\Model\Services\TaxManager"]=> string(38) "Shop\Factory\Manager\TaxManagerFactory" ["Shop\Model\Dao\TaxDao"]=> string(30) "Shop\Factory\Dao\TaxDaoFactory" ["ShopTaxGateway"]=> string(38) "Shop\Factory\Gateway\TaxGatewayFactory" ["Shop\Model\Services\TaxGroupManager"]=> string(43) "Shop\Factory\Manager\TaxGroupManagerFactory" ["Shop\Model\Dao\TaxGroupDao"]=> string(35) "Shop\Factory\Dao\TaxGroupDaoFactory" ["ShopTaxGroupGateway"]=> string(43) "Shop\Factory\Gateway\TaxGroupGatewayFactory" ["Shop\Model\Services\TaxRuleManager"]=> string(42) "Shop\Factory\Manager\TaxRuleManagerFactory" ["Shop\Model\Dao\TaxRuleDao"]=> string(34) "Shop\Factory\Dao\TaxRuleDaoFactory" ["ShopTaxRuleGateway"]=> string(42) "Shop\Factory\Gateway\TaxRuleGatewayFactory" ["Shop\Model\Services\PriceTableManager"]=> string(45) "Shop\Factory\Manager\PriceTableManagerFactory" ["Shop\Model\Dao\PriceTableDao"]=> string(37) "Shop\Factory\Dao\PriceTableDaoFactory" ["ShopPriceTableGateway"]=> string(45) "Shop\Factory\Gateway\PriceTableGatewayFactory" ["Shop\Model\Services\PriceTableConditionnementManager"]=> string(60) "Shop\Factory\Manager\PriceTableConditionnementManagerFactory" ["Shop\Model\Dao\PriceTableConditionnementDao"]=> string(52) "Shop\Factory\Dao\PriceTableConditionnementDaoFactory" ["ShopPriceTableConditionnementGateway"]=> string(60) "Shop\Factory\Gateway\PriceTableConditionnementGatewayFactory" ["Shop\Model\Services\WishListManager"]=> string(43) "Shop\Factory\Manager\WishListManagerFactory" ["Shop\Model\Dao\WishListDao"]=> string(35) "Shop\Factory\Dao\WishListDaoFactory" ["ShopWishListGateway"]=> string(43) "Shop\Factory\Gateway\WishListGatewayFactory" ["Shop\Model\Services\PromotionManager"]=> string(44) "Shop\Factory\Manager\PromotionManagerFactory" ["Shop\Model\Dao\PromotionDao"]=> string(36) "Shop\Factory\Dao\PromotionDaoFactory" ["ShopPromotionGateway"]=> string(44) "Shop\Factory\Gateway\PromotionGatewayFactory" ["Shop\Model\Services\PromotionItemManager"]=> string(48) "Shop\Factory\Manager\PromotionItemManagerFactory" ["Shop\Model\Dao\PromotionItemDao"]=> string(40) "Shop\Factory\Dao\PromotionItemDaoFactory" ["ShopPromotionItemGateway"]=> string(48) "Shop\Factory\Gateway\PromotionItemGatewayFactory" ["Shop\Model\Services\CartManager"]=> string(39) "Shop\Factory\Manager\CartManagerFactory" ["Shop\Model\Dao\CartDao"]=> string(31) "Shop\Factory\Dao\CartDaoFactory" ["ShopCartGateway"]=> string(39) "Shop\Factory\Gateway\CartGatewayFactory" ["Shop\Model\Services\CartItemManager"]=> string(43) "Shop\Factory\Manager\CartItemManagerFactory" ["Shop\Model\Dao\CartItemDao"]=> string(35) "Shop\Factory\Dao\CartItemDaoFactory" ["ShopCartItemGateway"]=> string(43) "Shop\Factory\Gateway\CartItemGatewayFactory" ["Shop\Model\Services\CartConstraintManager"]=> string(49) "Shop\Factory\Manager\CartConstraintManagerFactory" ["Shop\Model\Dao\CartConstraintDao"]=> string(41) "Shop\Factory\Dao\CartConstraintDaoFactory" ["ShopCartConstraintGateway"]=> string(49) "Shop\Factory\Gateway\CartConstraintGatewayFactory" ["Shop\Model\Services\CartRuleManager"]=> string(43) "Shop\Factory\Manager\CartRuleManagerFactory" ["Shop\Model\Dao\CartRuleDao"]=> string(35) "Shop\Factory\Dao\CartRuleDaoFactory" ["ShopCartRuleGateway"]=> string(43) "Shop\Factory\Gateway\CartRuleGatewayFactory" ["Shop\Model\Services\CartRuleRestrictionManager"]=> string(54) "Shop\Factory\Manager\CartRuleRestrictionManagerFactory" ["Shop\Model\Dao\CartRuleRestrictionDao"]=> string(46) "Shop\Factory\Dao\CartRuleRestrictionDaoFactory" ["ShopCartRuleRestrictionGateway"]=> string(54) "Shop\Factory\Gateway\CartRuleRestrictionGatewayFactory" ["Shop\Model\Services\OrderCartRuleManager"]=> string(48) "Shop\Factory\Manager\OrderCartRuleManagerFactory" ["Shop\Model\Dao\OrderCartRuleDao"]=> string(40) "Shop\Factory\Dao\OrderCartRuleDaoFactory" ["ShopOrderCartRuleGateway"]=> string(48) "Shop\Factory\Gateway\OrderCartRuleGatewayFactory" ["Shop\Model\Services\OrderCartRuleRestrictionManager"]=> string(59) "Shop\Factory\Manager\OrderCartRuleRestrictionManagerFactory" ["Shop\Model\Dao\OrderCartRuleRestrictionDao"]=> string(51) "Shop\Factory\Dao\OrderCartRuleRestrictionDaoFactory" ["ShopOrderCartRuleRestrictionGateway"]=> string(59) "Shop\Factory\Gateway\OrderCartRuleRestrictionGatewayFactory" ["PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentsModuleManager"]=> string(53) "Payments\Factory\Manager\PaymentsModuleManagerFactory" ["Payments\Model\Services\PaymentManager"]=> string(46) "Payments\Factory\Manager\PaymentManagerFactory" ["Payments\Model\Dao\PaymentDao"]=> string(38) "Payments\Factory\Dao\PaymentDaoFactory" ["PaymentsPaymentGateway"]=> string(46) "Payments\Factory\Gateway\PaymentGatewayFactory" ["Payments\Model\Services\PaymentTypeManager"]=> string(50) "Payments\Factory\Manager\PaymentTypeManagerFactory" ["Payments\Model\Dao\PaymentTypeDao"]=> string(42) "Payments\Factory\Dao\PaymentTypeDaoFactory" ["PaymentsPaymentTypeGateway"]=> string(50) "Payments\Factory\Gateway\PaymentTypeGatewayFactory" ["TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialsModuleManager"]=> string(61) "Testimonials\Factory\Manager\TestimonialsModuleManagerFactory" ["Testimonials\Model\Services\TestimonialManager"]=> string(54) "Testimonials\Factory\Manager\TestimonialManagerFactory" ["Testimonials\Model\Dao\TestimonialDao"]=> string(46) "Testimonials\Factory\Dao\TestimonialDaoFactory" ["TestimonialsTestimonialGateway"]=> string(54) "Testimonials\Factory\Gateway\TestimonialGatewayFactory" ["ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopAnalytics\Model\Services\ShopAnalyticsModuleManager"]=> string(63) "ShopAnalytics\Factory\Manager\ShopAnalyticsModuleManagerFactory" ["ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["ShopStructuredData\Model\Services\ShopStructuredDataModuleManager"]=> string(73) "ShopStructuredData\Factory\Manager\ShopStructuredDataModuleManagerFactory" ["CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\CheckoutModuleManager"]=> string(53) "Checkout\Factory\Manager\CheckoutModuleManagerFactory" ["Checkout\Model\Services\PaymentManager"]=> string(46) "Checkout\Factory\Manager\PaymentManagerFactory" ["Checkout\Model\Services\API\WebHookUrlManager"]=> string(53) "Checkout\Factory\Manager\API\WebHookUrlManagerFactory" ["RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["Recaptcha\Model\Services\RecaptchaModuleManager"]=> string(55) "Recaptcha\Factory\Manager\RecaptchaModuleManagerFactory" ["CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Caveschateauauvernier\Model\Services\CaveschateauauvernierModuleManager"]=> string(79) "Caveschateauauvernier\Factory\Manager\CaveschateauauvernierModuleManagerFactory" ["Sentry\ClientInterface"]=> string(36) "SentryIO\Service\ClientConfigFactory" ["Sentry\State\HubInterface"]=> string(27) "SentryIO\Service\HubFactory" ["SentryIO\Listener\ErrorHandlerListener"]=> string(45) "SentryIO\Listener\ErrorHandlerListenerFactory" ["Laminas\Db\Adapter\Adapter"]=> string(40) "Laminas\Db\Adapter\AdapterServiceFactory" } ["delegators"]=> array(4) { ["Laminas\Cache\Storage\AdapterPluginManager"]=> array(2) { [0]=> string(77) "Laminas\Cache\Storage\Adapter\Filesystem\AdapterPluginManagerDelegatorFactory" [1]=> string(76) "Laminas\Cache\Storage\Adapter\BlackHole\AdapterPluginManagerDelegatorFactory" } ["HttpRouter"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["Laminas\Router\Http\TreeRouteStack"]=> array(1) { [0]=> string(50) "Laminas\Mvc\I18n\Router\HttpRouterDelegatorFactory" } ["ViewHelperManager"]=> array(1) { [0]=> string(57) "Laminas\Navigation\View\ViewHelperManagerDelegatorFactory" } } ["aliases"]=> array(244) { ["Zend\Di\InjectorInterface"]=> string(28) "Laminas\Di\InjectorInterface" ["Zend\Di\ConfigInterface"]=> string(26) "Laminas\Di\ConfigInterface" ["Zend\Di\CodeGenerator\InjectorGenerator"]=> string(42) "Laminas\Di\CodeGenerator\InjectorGenerator" ["MvcTranslator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["Zend\Mvc\I18n\Translator"]=> string(27) "Laminas\Mvc\I18n\Translator" ["InputFilterManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["Zend\InputFilter\InputFilterPluginManager"]=> string(44) "Laminas\InputFilter\InputFilterPluginManager" ["HttpRouter"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["router"]=> string(34) "Laminas\Router\RouteStackInterface" ["Router"]=> string(34) "Laminas\Router\RouteStackInterface" ["RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\Http\TreeRouteStack"]=> string(34) "Laminas\Router\Http\TreeRouteStack" ["Zend\Router\RoutePluginManager"]=> string(33) "Laminas\Router\RoutePluginManager" ["Zend\Router\RouteStackInterface"]=> string(34) "Laminas\Router\RouteStackInterface" ["Laminas\Form\Annotation\AnnotationBuilder"]=> string(21) "FormAnnotationBuilder" ["Laminas\Form\Annotation\AttributeBuilder"]=> string(20) "FormAttributeBuilder" ["Laminas\Form\FormElementManager"]=> string(18) "FormElementManager" ["ValidatorManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Validator\ValidatorPluginManager"]=> string(40) "Laminas\Validator\ValidatorPluginManager" ["Zend\Mail\Protocol\SmtpPluginManager"]=> string(39) "Laminas\Mail\Protocol\SmtpPluginManager" ["TranslatorPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["Zend\I18n\Translator\TranslatorInterface"]=> string(43) "Laminas\I18n\Translator\TranslatorInterface" ["Zend\I18n\Translator\LoaderPluginManager"]=> string(43) "Laminas\I18n\Translator\LoaderPluginManager" ["navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Zend\Navigation\Navigation"]=> string(29) "Laminas\Navigation\Navigation" ["Core\Interfaces\AddressManagerInterface"]=> string(34) "Core\Model\Services\AddressManager" ["Core\Interfaces\AddressDaoInterface"]=> string(25) "Core\Model\Dao\AddressDao" ["Core\Interfaces\AddressTypeManagerInterface"]=> string(38) "Core\Model\Services\AddressTypeManager" ["Core\Interfaces\AddressTypeDaoInterface"]=> string(29) "Core\Model\Dao\AddressTypeDao" ["Core\Interfaces\AjaxRightManagerInterface"]=> string(36) "Core\Model\Services\AjaxRightManager" ["Core\Interfaces\AjaxRightDaoInterface"]=> string(27) "Core\Model\Dao\AjaxRightDao" ["Core\Interfaces\BankManagerInterface"]=> string(31) "Core\Model\Services\BankManager" ["Core\Interfaces\BankDaoInterface"]=> string(22) "Core\Model\Dao\BankDao" ["Core\Interfaces\BankAccountManagerInterface"]=> string(38) "Core\Model\Services\BankAccountManager" ["Core\Interfaces\BankAccountDaoInterface"]=> string(29) "Core\Model\Dao\BankAccountDao" ["Core\Interfaces\BankAddressManagerInterface"]=> string(38) "Core\Model\Services\BankAddressManager" ["Core\Interfaces\BankAddressDaoInterface"]=> string(29) "Core\Model\Dao\BankAddressDao" ["Core\Interfaces\CertificateManagerInterface"]=> string(38) "Core\Model\Services\CertificateManager" ["Core\Interfaces\CertificateDaoInterface"]=> string(29) "Core\Model\Dao\CertificateDao" ["Core\Interfaces\ClosedDayManagerInterface"]=> string(36) "Core\Model\Services\ClosedDayManager" ["Core\Interfaces\ClosedDayDaoInterface"]=> string(27) "Core\Model\Dao\ClosedDayDao" ["Core\Interfaces\ClosedDayTypeManagerInterface"]=> string(40) "Core\Model\Services\ClosedDayTypeManager" ["Core\Interfaces\ClosedDayTypeDaoInterface"]=> string(31) "Core\Model\Dao\ClosedDayTypeDao" ["Core\Interfaces\CmsListManagerInterface"]=> string(34) "Core\Model\Services\CmsListManager" ["Core\Interfaces\CmsListDaoInterface"]=> string(25) "Core\Model\Dao\CmsListDao" ["Core\Interfaces\CmsListItemManagerInterface"]=> string(38) "Core\Model\Services\CmsListItemManager" ["Core\Interfaces\CmsListItemDaoInterface"]=> string(29) "Core\Model\Dao\CmsListItemDao" ["Core\Interfaces\ContentManagerInterface"]=> string(34) "Core\Model\Services\ContentManager" ["Core\Interfaces\ContentDaoInterface"]=>